KEGG   Paracoccidioides lutzii Pb01: PAAG_06103Help
Entry
PAAG_06103        CDS       T02230                                 

Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00020  Citrate cycle (TCA cycle)
pbl00190  Oxidative phosphorylation
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01200  Carbon metabolism
Module
pbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAAG_06103
  Energy metabolism
   00190 Oxidative phosphorylation
    PAAG_06103
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAAG_06103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2 DNA_pol3_tau_4
Motif
Other DBs
NCBI-GeneID: 9095126
NCBI-ProteinID: XP_015700016
UniProt: C1H5Z3
LinkDB All DBs
Position
Unknown
AA seq 283 aa AA seqDB search
MASLRPTSRVLAASRPLFRSSVASRSYATVESASKTAESPTHTTSQTPKLKTFKIYRWNP
DKPTEKPRMQNYALDLNKTGPMMLDALIRIKNEQDPTLTFRRSCREGICGSCAMNIDGVN
TLACLCRIPTDTSKESRIYPLPHTYVVKDLVPDMTYFYKQYKSIKPYLQRDTPSPDGREI
RQSPADRKKLDGLYECILCACCSTSCPSYWWNSQEYLGPALLLQSYRWLADSRDEKTEER
KAALDNSMSVYRCHTILNCSRTCPKGLNPGLAIAEIKKMMAFA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttacgccctacctcccgtgtcctggccgcctcccgccctcttttccgctcc
tctgtagcctccagatcctatgctactgttgaatccgcttcgaaaacggccgaatcgccc
acccacacaacatcgcaaaccccaaaactcaagaccttcaagatctacagatggaacccc
gacaagccaaccgagaaaccgcgcatgcaaaactacgctctcgacctgaataagaccggc
cccatgatgctggacgccctgatcagaataaagaatgagcaggatcccaccctgaccttc
cggaggagctgcagagagggtatctgcggtagttgcgcgatgaacatcgacggcgtcaat
accttggcttgcttatgccgcatccccaccgacacctccaaagaatcgagaatctacccc
ctcccccacacctatgtggtcaaagatctcgtcccagacatgacctacttctacaagcag
tacaagtccatcaagccatacctgcaacgtgacactccatctccagatggtcgcgaaatc
cgccagtcacccgctgaccgcaaaaagctcgacggcctatacgaatgcatcttgtgcgcc
tgctgctcaacctcctgcccctcctactggtggaactctcaagaataccttggccctgct
ctgctgctgcagtcttaccggtggctagctgattcgcgtgacgagaagaccgaagagcgc
aaggcggccctcgacaatagcatgagcgtgtacagatgccataccatcctcaattgctca
agaacctgccccaagggactgaatccaggcttggctattgctgaaatcaagaagatgatg
gcctttgcgtag

DBGET integrated database retrieval system