KEGG   Paracoccidioides lutzii Pb01: PAAG_06764Help
Entry
PAAG_06764        CDS       T02230                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00500  Starch and sucrose metabolism
pbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAAG_06764
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PAAG_06764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966
Motif
Other DBs
NCBI-GeneID: 9094470
NCBI-ProteinID: XP_002791218
UniProt: C1H7M3
LinkDB All DBs
Position
Unknown
AA seq 531 aa AA seqDB search
MLRLFILCYLAGLALAADTVDWKSRSIYQVFTDRFARTDGSTSAKCDTNENLYCGGSWRG
IISKLDYIKEMGFDAIMISPVSKNVEGRVSYGEAYHGYWVQDLYQLNEHFGTRDDLIDLG
KEVHKRGMYLMVDIVINNMAFITNGRNPAIAVDYSVLNPFNRQRYYHPYCKIKDWNNYDE
AQKCWIGDDIVALPDLNTESEEVTQMMEAWVKEFVANYSVDGIRIDAAKHVGTEYLKKVA
KASGVFATGEVFESDVNTACSYQNYIPSIPNYPVYFAMIKAFTAGNITALNDELAAVKKV
CRDTSALVTFSENHDLPRFPSYVQDLSLAKNVLTFTILSDGIPSYYQGQELHFSGSQTPA
NREALWVSQYNTKHPLYQLTATLNKLRSHVIRTDAGYLSSVSYPIYRDGSSIAIHKGTDG
RHVLVVYSTQGENGNDYILSLGISYTPGLIVTEVLSCKNYSIGWPGSLGVEMTKGLPMVF
YPAHLMAGSGLCGASNVSAPVKGKTGESTSLRSGLTGWSVMLVAGFVVLLL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcctttttatactctgctacctcgccggactagcattagcagcggacaccgtc
gattggaaatccaggtcgatatatcaggtcttcacggacagatttgcgaggactgatggt
tcgacttcggcaaaatgcgatacgaacgagaacctctactgcggaggatcatggaggggc
ataatcagcaagttggactatattaaagaaatgggcttcgatgccatcatgatctcacca
gtctcgaaaaatgtcgaaggtcgcgttagttacggagaagcataccatggctactgggtt
caagatctataccaattgaacgaacattttggaactcgcgatgatcttatcgaccttgga
aaggaggtgcataagcgggggatgtacttgatggtcgatatcgtcatcaataacatggcc
ttcataacgaatggtagaaaccctgccattgcggtcgattactctgtcctcaacccattt
aaccggcaaaggtattaccacccgtactgtaagattaaggactggaataattacgatgag
gcgcaaaaatgttggataggggatgacatcgttgcacttccggatctcaacacggaatct
gaagaagtgacacagatgatggaggcctgggtcaaagaatttgttgcaaattactcagtt
gatggtattcgaattgatgccgcgaagcatgttggcacggaatacctgaagaaagtggcc
aaggcgtctggcgtttttgcaacaggcgaggtgtttgaaagcgatgtgaataccgcctgc
agttaccaaaattatatccccagcattccgaactaccccgtttacttcgccatgattaaa
gcctttactgctggaaacatcactgcgttgaatgatgaactcgccgcggtgaaaaaggtt
tgccgtgataccagtgcccttgtaaccttttcggagaaccacgatctccctcgattccca
tcttatgtccaagacctctctctcgccaagaacgtcctaaccttcacaatcctctccgat
ggcatccccagctattaccaaggacaagaactacacttctcaggatcccaaacccccgcg
aatcgcgaagccctctgggtctcacagtacaacaccaaacaccctctctaccaactaact
gcaaccctcaacaagttacgctcccacgtcatccgcaccgacgccggctacctctcatcc
gtctcctaccccatttacagagacgggagctccatcgccattcacaaggggactgatggc
cgtcatgtgcttgtcgtctactctactcagggtgagaatgggaatgactatatccttagt
ttgggcatttcatatacgcccgggctgatcgttacagaagttctgagctgtaagaattat
tcaattggttggcctgggtcccttggggttgagatgacgaaggggttgcccatggtgttc
tacccggcgcatctgatggctgggagcggcctgtgcggtgctagtaatgtgtctgctcct
gtcaaggggaagaccggggagtcgacgagtttaagatctgggctgacgggttggagcgtg
atgttggtggcggggtttgttgtgttattattatga

DBGET integrated database retrieval system