KEGG   Paracoccidioides lutzii Pb01: PAAG_07212Help
Entry
PAAG_07212        CDS       T02230                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl03030  DNA replication
pbl03410  Base excision repair
pbl03420  Nucleotide excision repair
pbl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PAAG_07212
   03410 Base excision repair
    PAAG_07212
   03420 Nucleotide excision repair
    PAAG_07212
   03430 Mismatch repair
    PAAG_07212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pbl03032]
    PAAG_07212
   03400 DNA repair and recombination proteins [BR:pbl03400]
    PAAG_07212
Enzymes [BR:pbl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PAAG_07212
    6.5.1.6  DNA ligase (ATP or NAD+)
     PAAG_07212
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PAAG_07212
DNA replication proteins [BR:pbl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PAAG_07212
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PAAG_07212
DNA repair and recombination proteins [BR:pbl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PAAG_07212
   NER (nucleotide excision repair)
    Other NER factors
     PAAG_07212
   MMR (mismatch exicision repair)
    Other MMR factors
     PAAG_07212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 9094153
NCBI-ProteinID: XP_002790976
UniProt: C1H8X1
LinkDB All DBs
Position
Unknown
AA seq 850 aa AA seqDB search
MPIPAKKRKLNEPGPANQRTRGIESFFRSQKSASATITPVQLEPGTPLADEALARKLQAK
WDEEAKSGNQCSSNLQGYQHPSTLETKPEGLTQEFGTRLQTHGTSVCGDVSGNGKPNRVL
SLQISSSAEDTISQSIPFDQSPLTFEPSSYAENLRAHWALEGGHASYAILTRAFVLVNNT
QSRIKIVDTLVNLLRLLIEADPDSLIFAVWLATNAIAPPYVPVELGLGGSAISKALKTAY
GLNNQGLKTLWDKYGDAGDVAFEAKKRQTFTLRKPKPLSIRGVYESLLKISRSKGPGSQE
IKQRIVEKLLQDARGAEESRYIVRTLVQHLRIGAVKTTMLIALARAFLYSRPSTKDFFVN
NRTELSKLKREEMASIYSRAEEIVKASYARHPSYDDLVSCLLEIGISDELLVRCGLTLHV
PLHPMLGSITRDLAQMLTKLQGRAFTCEYKYDGQRAQVHCDSSGKVSIFSRHLELMTDKY
PDLVALIPRIRGEGVSSFILEGEIVAVNQETGELLAFQTLTNRAKKNVGIESIEISVCLF
AFDLMLLNGEPLLERPLRERRELLRGLFIEVPHHFTWVKNLDATSSDSEAVLSFFKEAID
AKCEGLMVKLLDDSVQPELSKYESVAEPNLNSDLLLTTGPVEPNGNNKTRARRSLLSTYE
PDKRLESWLKVKKDYNAASDTLDLIPIAAWHGQGRKAKWWSPILLAVRNPETGMLEAVTK
CISGFTDKFYQANKEKYAEGSDNIISRPSYVDYRSEPEVWFEPQEVWEVAFADITLSPTY
TAAIGLVSDERGLSLRFPRFVRVREDKGLEEASSSDYLANLWRKQTERLQEEGAIAKPIT
ESNHFGSEDD
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcctgctaaaaagcgcaagttaaatgagcctggaccggcgaaccaacggact
cgaggaatcgaatcattcttccggagccaaaaatctgcttcggcaacaatcactcctgtt
caactggaacccgggaccccgttagcggacgaggcactcgcgcgcaaattgcaggcgaaa
tgggatgaagaagctaaatccggtaatcagtgctctagtaacctccagggctaccagcat
ccgtcgacactggaaaccaaacccgaagggcttacacaggaatttggcactcgactacag
actcatggtacctctgtgtgtggtgatgtttctgggaatgggaaaccgaatagagtctta
tcattacaaatctcttctagcgctgaggatactatttcccagtcgataccgtttgaccaa
agtcctctcacttttgaaccttcatcttatgcagagaatttgcgggcccactgggcgctc
gaagggggccacgcatcttatgccattcttacgagagcttttgttctcgtcaataacact
caaagccggattaagattgtcgatacactagtcaatctcctgaggttactcatagaagct
gacccggacagtctcatttttgcagtgtggcttgcaaccaatgcgattgcccctccatat
gttccagtggagttagggttgggcgggtctgctatatcaaaagcattgaaaactgcatat
ggattaaacaaccaaggattgaaaactctgtgggataagtatggtgatgcaggggatgtt
gccttcgaggcgaagaaaaggcagacgtttacgttaaggaagccaaaaccgctatcaatt
agaggagtctacgaatctctcttgaaaatttctagaagcaaggggccgggaagccaggaa
atcaaacaacgaatcgttgagaaactcctccaagatgcgcgaggcgcggaggaaagcaga
tacattgtgcgaacacttgtacagcatctccgcattggcgcggtgaaaacaaccatgctc
attgctctggctagagcttttctttactctagaccttctacgaaagatttctttgtaaac
aaccgaaccgagctatcaaaactcaaaagggaagaaatggcgagcatctacagcagggcg
gaggaaatcgtgaaagcttcttatgctcgacatcccagctacgacgatttagtatcatgt
cttttggaaatcggtatttcagatgagcttcttgtgagatgtgggctaactctccatgtg
ccattacacccaatgctgggaagcataacaagggatctagcgcagatgcttaccaaactc
caagggagagcttttacctgcgaatataagtatgacggacaacgggcccaagtacactgt
gattcttcaggcaaagtctccatcttttctcgacatctggaactcatgacggacaaatat
cctgacttggttgccctaatccctcggattcggggtgagggtgtatccagttttatttta
gagggggaaattgttgcggtgaaccaagaaactggggagctattggcatttcagactctt
accaaccgtgctaaaaagaatgttggcatcgagagcatcgagattagtgtatgcttgttc
gcatttgatctcatgcttttgaatggtgaaccgttactagagaggccactccgggagaga
cgagagctccttcgaggtctgttcatcgaggttccacaccatttcacttgggtcaaaaat
cttgatgcgacatcgtctgattcggaagcggtgctgagttttttcaaggaagctattgat
gcgaaatgcgaggggctgatggttaagttgctcgatgattctgttcaacctgaattatct
aaatatgaatctgttgcagagccgaaccttaacagtgatttattattaacaacaggccct
gttgaaccaaacggtaacaacaaaactagagctcggcgatccctgctctctacttatgag
ccagataagcggctcgagtcgtggcttaaagtgaagaaagattacaatgctgcatctgat
actttggacttaatcccgattgcagcttggcacggacaaggcaggaaggccaaatggtgg
tctcctatccttcttgccgttcgaaatcctgaaactggcatgcttgaagctgtcaccaag
tgcatatccggtttcacagacaagttctatcaagcaaataaggaaaagtatgcagaagga
agtgataatattatatcaagaccgagctatgtggactacagaagcgaaccagaggtttgg
ttcgagccgcaggaagtctgggaagtagcatttgcagacattaccctgagccccacgtac
acagcggcaattgggctcgttagcgatgagcgaggacttagtcttcgattcccaagattt
gtcagagttcgtgaggataaaggtcttgaagaagcaagcagttccgattatctggcgaat
ttatggcggaagcagaccgaacgacttcaggaagaaggggcaatagctaaacctatcacg
gaaagcaaccattttggatctgaggatgattga

DBGET integrated database retrieval system