KEGG   Paracoccidioides lutzii Pb01: PAAG_08207Help
Entry
PAAG_08207        CDS       T02230                                 

Definition
(RefSeq) alanine aminotransferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00220  Arginine biosynthesis
pbl00250  Alanine, aspartate and glutamate metabolism
pbl01100  Metabolic pathways
pbl01200  Carbon metabolism
pbl01210  2-Oxocarboxylic acid metabolism
pbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAAG_08207
   00220 Arginine biosynthesis
    PAAG_08207
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pbl01007]
    PAAG_08207
Enzymes [BR:pbl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PAAG_08207
Amino acid related enzymes [BR:pbl01007]
 Aminotransferase (transaminase)
  Class I
   PAAG_08207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9093120
NCBI-ProteinID: XP_002789953
UniProt: C1HBR6
LinkDB All DBs
Position
Unknown
AA seq 556 aa AA seqDB search
MANRHISNFCSLSRRYCRPHPLSIPVDAHCTRPRLLGLQGFPRISSSSPPSVSPIFHLQL
RNMGSVSKSEPKGRLHGGNINPNVLAAKYAVRGELAVKAEEYRERLANAEKENIQDVLPF
DKVIFANIGNPQQLDQKPITFFRQVLSILEHPALLENEEALKTSFGYKQDVIDRAKRLLK
GVQSVGAYSQSHGVPVIRESVAKFIERRDGFPADPARIYLTAGASSGVNTLLHVLCAGPK
TGVLVPIPQYPLYTATLSLLNAKCVPYYLNESDSWGTDVDGIRSTISQAKEDGIDVRAIV
VINPGNPTGASLTSDSVKGVIDVAVESNLVILADEVYQANVFEGDFTSFKKRLRQLQRDF
PSQYDHVELASLHSISKGMVGECGHRGGYIELVGFHEDVLENIYKFISIMLCAPVVGQCL
VEMMVNPPVEGDPSFELYQKEYNSIRDGLYQRAQTLYKAFQQMEGVECQEPKGAMYLFPT
IHLPPKAIEAAKAANREPDEFYSLRLLDATGVCVVPGSGFGQKDGTLHFRTTFLAPGTAW
TDRIVKFHKEFMDEFR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcgacacatatcgaatttctgctcgctctcacggcgctattgtcgcccccac
cccttgtcaattccagtcgatgctcattgtacaagaccccggttgctaggtctccaaggc
tttccccgcatttcctcttcatcgccaccgtctgtttcaccaatattccacctccaactt
cgaaatatgggctccgtctcaaaatcggaaccaaaaggccgtcttcatggcggcaacatc
aatcccaatgtcttggctgccaagtatgcggtccgtggtgaactagccgtcaaggcggag
gaatatcgtgagagactggccaatgctgaaaaggaaaatatccaagacgtgctccccttt
gacaaggtcatcttcgccaatatcggaaatccgcaacaattagaccaaaaacccatcaca
tttttccgccaggtccttagcattctcgagcacccggccctgctagaaaatgaggaagcg
ctgaagacctcctttggctacaaacaggatgtcattgacagagcaaagaggctgctgaaa
ggtgtccaaagcgtgggcgcgtacagccagagtcatggggttccggtcatacgggagagt
gttgccaaattcatcgagcgccgcgatggcttcccggcggatccggcccgtatttatctc
actgccggagcatcgtccggagtcaacaccttgctccatgtgctctgcgctggcccaaaa
actggtgtgctcgtacccattccgcaatatccgctctatactgccaccttgtccctgtta
aatgccaaatgcgtgccatattatcttaacgaaagcgactcttggggtaccgatgtagat
gggatcagatcaaccatttcacaggccaaggaggatggaatcgatgtccgtgccatcgtg
gtcattaaccctggaaatccaaccggtgctagtttaacctcggactcggtcaagggtgtt
atcgatgtcgcagtcgaatccaacctcgtgatcttggccgatgaagtctaccaagccaac
gtcttcgagggagattttacttcattcaaaaagcgcctacgacaactccaacgagacttc
ccgagtcaatatgatcatgtcgaactagcgtcgctgcatagcatttcgaaaggcatggtt
ggtgaatgtggtcacagaggcggttatatcgaactcgtcggcttccacgaggatgtcttg
gagaacatctacaaatttatcagtatcatgctctgcgctccagtcgttggacaatgtctc
gttgagatgatggttaaccctcccgtagaaggagatcccagtttcgagctgtaccagaaa
gagtataatagcattcgagacggcctgtatcagcgtgcccaaaccctttacaaggcattc
cagcagatggagggcgttgaatgtcaagaacccaagggcgccatgtatctcttcccaacc
atacatctaccacccaaagcgatcgaagctgccaaagcagccaaccgcgaaccagacgaa
ttttactccctccgcctcctggatgccacaggggtctgcgtcgtccctggatccggcttc
ggtcagaaagatggcactctccacttccgcaccacgttcttagcaccaggcactgcatgg
acggatcgcatcgtcaagttccacaaggaattcatggatgaatttagatga

DBGET integrated database retrieval system