KEGG   Paracoccidioides lutzii Pb01: PAAG_08303Help
Entry
PAAG_08303        CDS       T02230                                 

Definition
(RefSeq) glutathione S-transferase 103-1A
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAAG_08303
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pbl02000]
    PAAG_08303
Enzymes [BR:pbl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PAAG_08303
Transporters [BR:pbl02000]
 Other Transporters
  Pores ion channels [TC:1]
   PAAG_08303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_N_4 GST_C
Motif
Other DBs
NCBI-GeneID: 9093075
NCBI-ProteinID: XP_002789866
UniProt: C1HC12
LinkDB All DBs
Position
Unknown
AA seq 254 aa AA seqDB search
MSRYPVATGAAKALVDKHAAELPLKLYAGWFCPYVQRTWITLEEKKIPYQYIEINPYDKS
PFFLALNPKGLVPTLIAPQPNNKPSKPLYESNIIDEYLEEAFPENTPHLLPQDPYERARA
RIWINFVDSRITPNYRKLQLAKSTDDLHAARGEFLKALKEFTRAMHGEGPYFFGGEIGLT
DIALAPWAVRFWKAEKFKEGGLGIPAEGKGEEDEGVWARWRKWEKAVLGRESVKNTLSER
EYYERLAKMDWAKI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttatccagttgcaacaggtgccgcgaaggccctggtagacaaacacgcagcg
gagcttcccttgaaactctatgctggctggttttgcccatacgtccaacgcacctggatc
accctcgaagaaaaaaagatcccataccaatacatcgaaataaacccctatgacaaatcc
cccttcttcctcgccctgaacccaaagggcctcgtcccaacccttatcgccccccaacca
aacaacaaaccctccaaacccctctacgaatcaaacatcatagacgaatacctcgaagaa
gccttcccagaaaacaccccacacctgcttccccaggacccctacgagcgcgcccgcgcc
cgcatctggatcaacttcgtcgacagccgcatcacccccaactatcgcaagttacaactg
gccaagtcgacagacgacctccatgcggcgcgcggggagtttttgaaggcgcttaaggaa
ttcacgcgggcgatgcatggcgagggaccttatttctttggtggggagatagggttgacg
gatattgcgctggcgccgtgggcggtgaggttttggaaggcggagaagttcaaggagggt
gggcttgggattccggccgaagggaagggggaagaggatgagggggtttgggcgcggtgg
aggaagtgggaaaaggctgttttggggagggagagtgtgaagaatacgttgagtgagagg
gagtattatgagaggttggcgaagatggattgggcgaagatttga

DBGET integrated database retrieval system