KEGG   Paracoccidioides lutzii Pb01: PAAG_08351Help
Entry
PAAG_08351        CDS       T02230                                 

Definition
(RefSeq) mitochondrial NADP-specific isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00020  Citrate cycle (TCA cycle)
pbl00480  Glutathione metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01200  Carbon metabolism
pbl01210  2-Oxocarboxylic acid metabolism
pbl01230  Biosynthesis of amino acids
pbl04146  Peroxisome
Module
pbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAAG_08351
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAAG_08351
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PAAG_08351
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PAAG_08351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9092964
NCBI-ProteinID: XP_015701152
UniProt: C1HC60
LinkDB All DBs
Position
Unknown
AA seq 492 aa AA seqDB search
MLSVLPTSVHTRHSLSLLSLVPSPCARPVGRSLSTFSKKYSYSSSSPSSLSSSYPSSSPS
LRPSALVHNSSVPVRNTPERTRWVSIPTTQARNMAASRRKIVVKNPVVELDGDEMTRIIW
KDIKDKGLEYRDKTNDQVTIDSAEAIKKYGVGVKCATITPDEERVKEFNLKQMWLSPNGT
IRNILGGTVFREPIVIKRIPRLVPGWQKPIIIGRHAFGDQYRAKDTVIPGPGTLELVYTP
KGGQPERIKVFDFEGGGVAMSQYNTDDSISGFAHASFKLAILKGMPLYMSTKNTILKKYD
GRFKDIFQSIYESTYKKSFDAKGIWYEHRLIDDMVAQMIKSEGGFIIAMKNYDGDVQSDI
VAQGFGSLGLMTSTLTTPDGTAFESEAAHGTVTRHYREHQKGRETSTNPIASIFAWTRGL
VRRGQLDNTPDVVAWAEQLEQACIDVVDEEGIMTKDLALACGRKDRAAWVTTRVYLEAVE
RRLQKNLANAKL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgtgctgccaacatccgttcatacccgacactcactctcgctgctctctctt
gtcccgtccccttgtgctcgcccagtcggccggtctttatccactttctctaagaaatat
tcttattcttcttcctccccttcctccctctcctcctcctacccctcctcgtctccctcc
ttgcgcccttctgccctcgtccacaactcctccgtccccgtccgcaatactcctgagagg
actcgctgggtatcgattcctacaacacaggctcgcaacatggctgcgtcccggcggaag
atcgtggtgaaaaaccccgtggtggaattggatggtgatgagatgacaaggattatttgg
aaagacatcaaggataaaggcttggagtaccgtgataaaaccaatgatcaagttacgatt
gattccgcagaggcgatcaagaagtatggggtaggcgtgaaatgcgctactattactcca
gatgaggagagagttaaagaattcaacctcaagcagatgtggttgtctcccaacggaact
atcagaaacatcctaggtggaaccgtcttccgtgaaccaattgtcatcaaacgcatcccc
aggttggtaccaggctggcaaaaacccattatcatcggtcgacatgcctttggcgaccaa
taccgtgccaaagatacagttattccaggtcccggtactctcgagctcgtctatacaccc
aagggtggccagccagagcgcatcaaggtctttgacttcgaaggtggcggtgtagccatg
agccaatacaacaccgacgactcgatctccggctttgcccatgccagcttcaaactggcc
atcttaaaaggaatgcccctatacatgagcaccaagaataccatcctcaagaaatacgac
gggagatttaaggatattttccagtctatctacgaatctacttacaagaagagctttgat
gccaagggcatctggtacgagcatagactcatcgatgatatggttgcgcagatgatcaag
agcgaaggcggcttcatcattgccatgaagaactacgacggcgacgtccaatccgacatt
gtagcccaaggctttggctccctcggcctcatgacctcaactctcacaacgcccgacggc
accgccttcgaatccgaagccgcccacggcaccgttacccgccactaccgcgagcatcaa
aagggccgcgaaacctccaccaaccccatcgcatccatcttcgcctggactcgtggcctc
gtccgccgcgggcagctggacaacaccccggacgtggttgcgtgggctgagcagctggag
caggcgtgcattgatgttgtggatgaggaggggattatgactaaggaccttgcgttagcg
tgtgggaggaaggatcgggcagcgtgggtgacgacgagagtgtatctggaggcggttgag
aggaggttgcagaagaatttagcgaatgcgaaattgtag

DBGET integrated database retrieval system