KEGG   Paracoccidioides lutzii Pb01: PAAG_12525Help
Entry
PAAG_12525        CDS       T02230                                 

Gene name
PAAG_08248
Definition
(RefSeq) chlorophyll synthesis pathway protein BchC
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_7 Shikimate_DH FAD_binding_3 Pyr_redox_3 2-Hacid_dh_C Sacchrp_dh_NADP DAO Pyr_redox_2 adh_short ThiF
Motif
Other DBs
NCBI-GeneID: 9093046
NCBI-ProteinID: XP_015702375
UniProt: A0A0A2V347
LinkDB All DBs
Position
Unknown
AA seq 342 aa AA seqDB search
MKAARFYAAGDIRVEDVDPPQATNDKVLVEVEWCGICGSDLNEYVRGPYAIPDEKKGPHH
LTGEMLPVTLGHEFSGRVVQAPPTSSLVPGQPVAIDPRHVGSLGLSGGGGGLSEMVSVHP
AMLHPLPNGTDLAAAALIEPLAVAWRAVKRSGLSNLKNAPVLVIGAGPIGVATVFVLKAE
GCDMILVSEKAARRREFLADIVHAAFDPTEVNIVEKCRELTGGAGVEIVIDCAGAQSGFE
HGCDSLRVHGTYVNLAIPKAPATLPFEHFLLKELTFKTFLAYDETDFKEVVAAFGSGRFA
GVERMITRRISLDEIVEKGFKELTEKPGDHIKIIASPKIGLL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttctatgctgcgggagatatccgtgttgaggatgtggacccgccg
caagcaactaatgataaggttctggtggaagtagaatggtgtggaatttgcggaagcgac
ctcaatgaatatgttcgaggaccctacgcaatccctgacgaaaagaagggacctcatcat
cttactggcgagatgttgccagtcacattgggtcatgagttctccggacgagtcgttcag
gcaccacctacatcctctctcgtcccagggcagccagtagccattgatccgcgacatgtg
ggatctcttggtctgtctgggggaggaggggggctttctgaaatggtttctgttcatccg
gccatgcttcatccgcttccgaatgggactgatctggctgcagcagcattgatcgagccc
ctggcggttgcctggcgtgctgtcaaacgcagtggacttagcaatttaaaaaatgctccc
gttttggtcattggtgcagggcctattggcgtggccacggtatttgtattaaaggcagag
ggttgcgatatgatattggtgtctgagaaggctgcgcgccgtcgggaatttctggctgac
attgttcacgctgcttttgatcctacagaggtcaatattgtggagaaatgcagggaactc
acgggcggagctggggtggaaatagtaatcgattgcgccggggcccagtcaggatttgaa
catggctgcgatagcctcagggtacatggtacttatgtcaatttggcaattccaaaagct
ccagcgacgctcccttttgagcacttcctactaaaggagctaacattcaaaacctttttg
gcgtatgacgagacagacttcaaagaagtggtagctgcctttggctcagggcgatttgcg
ggggtagaaaggatgattacccgccgtatctccttagatgagatcgtggagaaggggttc
aaagagctcacagagaaacccggggatcatataaagatcatagccagcccgaaaatcggg
ttactatga

DBGET integrated database retrieval system