KEGG   Pseudomonas balearica: CL52_00025Help
Entry
CL52_00025        CDS       T03573                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pbm  Pseudomonas balearica
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CL52_00025
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CL52_00025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 K_oxygenase FMO-like Glutaredoxin NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: AJE13504
LinkDB All DBs
Position
6774..8339
Genome map
AA seq 521 aa AA seqDB search
MLDSNLKTQLKAYLEKVTQPFEIVASLDDSAKSEEMLALLNDINGLSDKISLNTAGNDAR
RPSFALVRHDREIDLRFAGLPMGHEFTSLVLALLQVGGHPSKLAPELIEQIQALEGEYRF
ETYFSLSCQNCPDVVQALNLMAVLNPNIHHVAIDGALFQDEVEARQIMSVPSLYLNGEPF
GQGRMGVEEILAKLDTGAGARDAEKLKAKSAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQALDTMAIENFISVKETEGPKLACALEEHVREYEVDVMNLQRASQLIPAGDDGL
HTVRFDNGGELKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGESLRADAVLQRKLQSLPNVTILTMAQTTEVKGDGQ
KVTGLVYKDRHSDEVQDLELEGIFVQIGLLPNSDWLKGTVNLSRFGEIEVDAKGQTNIPG
VFAAGDVTTVPYKQIVIALGEGAKASLSAFDHLIRSSAPVI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatagcaatctcaagacccaactgaaggcctacctggaaaaggtcacccagccg
ttcgagatcgtcgcttcgctggacgacagcgccaagtccgaggaaatgctcgcgctgctg
aacgacatcaacggcctgagcgacaagatcagcctgaacaccgccggcaacgatgcgcgc
cggccgtcgtttgccctggtgcgccacgaccgcgagatcgacctgcgtttcgccggcctg
cccatgggccatgagttcacctcgctggtgctcgcgctgctgcaggttggcggccatccg
tcgaagctggcgccagagctgatcgagcagatccaggcgctcgagggcgaataccgcttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaaccccaacatccaccacgtggccatcgacggcgcgctgttccaggat
gaggtcgaagcgcggcagatcatgtcggtgccgagcctctacctcaacggcgaacccttc
ggccagggccgcatgggcgtcgaggagatcctcgccaagctcgacaccggcgccggtgcg
cgtgatgccgagaagctcaaggccaagagtgccttcgacgtgctcgtcatcggtggcggc
ccggccggcgctgcggcggcgatctacgccgcgcgcaagggcatccgcaccggcgtcgcc
gccgagcgcttcggcggccaggcgctggacaccatggccatcgagaacttcatctcggtg
aaggaaaccgaaggcccgaaactggcctgcgcgctcgaagaacacgtgcgcgagtacgag
gtcgacgtgatgaacctgcagcgtgccagccagctgatcccggcgggcgacgacggcctg
cacaccgtgcggttcgacaacggcggcgagctcaaggccaagaccctgatcctcgccacc
ggggcgcgctggcgcgagatgaacgtgcccggcgagcaggaataccgcggccgcggcgtc
gcctactgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaactctggcgtcgaggcggcgatcgacctggccggcatcgtcgcccacgtcacc
ctgctggagttcggcgagagcctgcgggccgacgcggtgctgcagcgcaagctgcagagc
ctgccgaacgtgaccatcctgaccatggcgcagaccaccgaggtcaagggcgacgggcag
aaggtcaccgggctggtctacaaggaccgccacagcgacgaggtccaggacctcgagctc
gaaggcatcttcgtgcagatcggcctgctgcccaacagcgactggctcaagggcacggtc
aacctgtcgcgcttcggcgagatcgaggtcgacgccaagggccagaccaacatccccggc
gtgttcgccgccggtgacgtgaccacggtgccctacaagcagatcgtcatcgccctcggc
gaaggcgccaaggcctcgctgtcggccttcgaccacctgatccgcagcagtgccccggtg
atctga

DBGET integrated database retrieval system