KEGG   Pseudomonas balearica: CL52_00985
Entry
CL52_00985        CDS       T03573                                 

Definition
(GenBank) type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
pbm  Pseudomonas balearica
Pathway
pbm02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    CL52_00985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbm02044]
    CL52_00985
Secretion system [BR:pbm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CL52_00985
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AJE13684
UniProt: A0A1G9P631
LinkDB
Position
complement(230687..232165)
AA seq 492 aa
MSTSAAAVDSGNNLADLGILDRIIAETKLTPDDEAYDIAKRGVSAFIEELLKPQNEHEPV
KKALVDRMIAEIDAKLSQQMDEILHHPQFQALESSWRGLKLLVDRTNFRENIKLEILNAS
KQDLLDDFEDSPEVVQSGLYKHIYTAEYGQFGGQPVGALIANYFFDPSAPDIKTMQYVAS
VASMSHAPFIAAAGPKFFGLESFTGLPDLKDLKDHFDGPQFAKWQSFREQEDARYVGLTV
PRFLLRNPYDPEDNPVKSFVYKENVAGSHEHYLWGNTAYTFASRLTDSFAKFRWCPNIIG
PQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMRKGSDNAAFFS
ANSAQKPKFFGNSEEGKNAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLE
LELNKWIRQFVADQENPSAEVRSRRPLRAAQVVVSDVEGEPGWYRVSLNVRPHFKYMGAD
FTLSLVGKLDKE
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgagcactagcgcagcagccgtcgacagcggcaacaacctcgccgacctcggcattctc
gaccggatcatcgccgagaccaaactgacccctgacgacgaggcctacgacatcgccaag
cgcggcgtatcggccttcatcgaagaactgctcaagccacagaacgagcacgagccggtg
aagaaggcgctggtcgaccgcatgatcgcggagatcgacgccaagctcagccagcagatg
gacgagatcctccatcatccgcaattccaggcgctcgaatcctcctggcgcggcctcaag
ttgctggtcgaccgcaccaatttccgcgagaacatcaagctggaaatcctcaacgcctcc
aagcaggacctgctggatgacttcgaggacagcccggaagtcgtccagtcgggcctgtac
aagcacatctataccgccgagtacggccagttcggtggccagccggtcggcgcgctgatc
gcgaactacttcttcgacccgagcgcccccgacatcaagacgatgcagtacgtggcatcg
gtcgccagcatgtcccacgcgcccttcatcgccgccgctggcccgaaattcttcggcctg
gaaagcttcaccggcctgccggacctgaaggacctgaaggatcatttcgatggcccgcag
ttcgccaaatggcaaagcttccgcgagcaggaagacgcccgctacgtcggcctgaccgta
ccgcgcttcctcctgcgcaacccctacgacccggaagacaacccggtcaaatccttcgtc
tacaaggaaaacgtcgccggcagccacgagcactacctgtggggcaacaccgcctacacc
ttcgccagccgcctgaccgacagtttcgccaagttccgctggtgcccgaacatcatcggc
ccgcagagcggcggcgcggtggaagacctgccgctgcaccacttcgagagcatgggcgag
atcgagaccaagatcccgaccgaggtgctggtctccgaccgccgcgaatatgagctggcc
gaggaaggcttcatcgccctgaccatgcgcaagggcagcgacaacgccgcgttcttctcg
gccaactccgcgcaaaagccgaagttcttcggcaacagcgaggaaggcaagaacgctgag
ctgaactacaagctcggcacccagctgccgtatctgttcatcgtcaaccgcctggcgcac
tacctgaaggtgctgcagcgcgagcagatcggcgcctggaaagagcgcaccgacctcgaa
ctggaactgaacaagtggatccgccagttcgtcgccgaccaggaaaaccccagcgccgaa
gtccgcagccgccggccgctgcgcgccgcccaggtcgtcgtcagcgatgtagaaggcgag
ccgggctggtaccgcgtcagcctgaacgtgcgcccgcacttcaagtacatgggcgccgac
ttcaccctgtcgctggtcggcaagctggacaaggaataa

DBGET integrated database retrieval system