KEGG   Pseudomonas balearica: CL52_07605Help
Entry
CL52_07605        CDS       T03573                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CL52_07605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pbm02000]
    CL52_07605
Enzymes [BR:pbm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CL52_07605
Transporters [BR:pbm02000]
 Other Transporters
  Pores ion channels [TC:1]
   CL52_07605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJE14918
UniProt: A0A1G9SET5
LinkDB All DBs
Position
complement(1627634..1628305)
Genome map
AA seq 223 aa AA seqDB search
MITVHHLEHSRSHRVLWLLEELGLAYELRRYARDPDTLLAPADLKAVHPLGKSPVVTDGD
LTVAESAAILEYLLDAHDEGRLRPLPGTPAYLRYRYWLHYAEGSAMPPLLLRLVFDRVAQ
APMPFFVRPIAKAIATKANKAFIGPQLDLHLDYMEAELAKTRWFAGDEFSAADIQMSYPI
GAAAARAGLNESRPRLMDYLARIQTRPAYQRATERGGPPIPGQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccaccatctggaacattcccgctcgcaccgcgtgctctggctgctcgag
gagctagggctcgcctacgagctacgccgctatgcgcgcgacccggataccctgctcgcc
ccggccgacctcaaggcggtgcacccgctcggcaagtccccggtcgtgaccgatggcgac
ctgactgtcgccgagtctgcggcgattctggagtacctgctggatgcgcatgatgaaggc
cgtctgcggcctttaccgggtacgccggcttatttgcgctatcgctactggctgcactat
gccgagggctcggccatgccgccgttgctgctacggctggtattcgatcgcgtggcgcag
gcgccgatgccgttctttgtccgacctatcgcaaaggcgatcgccaccaaggccaacaag
gccttcatcggcccgcagttggacctgcacctggattatatggaggccgaactggccaag
acccgctggttcgccggcgacgaattcagcgcggccgacattcagatgagttatccgatc
ggagcggccgctgcccgggccggcctgaacgagagccgcccgcgactgatggattatctg
gcacgcatccaaacgcgtccggcttaccaacgggcaaccgaacgcggcggaccgccaatc
cccgggcagtga

DBGET integrated database retrieval system