KEGG   Pseudomonas balearica: CL52_08270
Entry
CL52_08270        CDS       T03573                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00020  Citrate cycle (TCA cycle)
pbm00190  Oxidative phosphorylation
pbm00650  Butanoate metabolism
pbm01100  Metabolic pathways
pbm01110  Biosynthesis of secondary metabolites
pbm01120  Microbial metabolism in diverse environments
pbm01200  Carbon metabolism
Module
pbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CL52_08270 (sdhA)
   00650 Butanoate metabolism
    CL52_08270 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CL52_08270 (sdhA)
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CL52_08270 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CL52_08270 (sdhA)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA FAD_binding_3 HI0933_like Thi4 Pyr_redox_3 FAD_oxidored NAD_binding_7 NAD_binding_8
Other DBs
NCBI-ProteinID: AJE15043
UniProt: A0A1G9RF17
LinkDB
Position
1766142..1767914
AA seq 590 aa
MANIRTLSFDAIIVGGGGAGMRAALQLSQSGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTETGRIYQRP
FGGQSKDYGKGGQAARTCAAADRTGHALLHTLYQGNLKNDTTFLNEWYAVDLVKNQDGAV
VGVIAICIENGETVYIRSKATVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
LAGNGCGPDGDHVMLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GIATNIHGQAITQDANGNDKIIDGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKEGIEHRGASETDLDVALARLAGVNERTTGEDVAPLRKELQNCMQNYFGVFRTGE
YMQKGIAQLSDLRQRIANVKIADKSQAFNTARIEALELQNLLEVAEATAVAAEARKESRG
AHAREDFEERDDENWLCHTLYFPGEKRVGKRAVNFAPKTVPAFEPKVRTY
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggctaacattcgtacgctttccttcgatgccatcatcgttggcggtggtggcgccggt
atgcgcgctgcgctgcagctctcccagtcggggcataagaccgccgtggttaccaaggtc
ttcccgacccgttcgcacaccgtgtctgctcagggtggcatcacctgtgcgatcgcctct
gccgacccgaacgatgactggcgttggcacatgtacgataccgtcaagggctccgactat
atcggtgaccaggacgcgatcgaatacatgtgctcggtcggcccggaagccgtgttcgaa
ctcgagcacatgggcctgccgttctcccgtaccgaaaccggtcgcatctaccagcgtccg
ttcggcggtcagtccaaggactacggcaagggtggccaggctgcccgtacctgtgccgct
gccgaccgtaccggccacgcgctgctgcacaccctttatcagggcaacctgaaaaacgac
accaccttcctcaacgagtggtatgcagtcgacctggtgaaaaaccaggatggcgcagtg
gtcggtgtcatcgccatctgcatcgagaatggcgaaaccgtctacattcgctccaaggcc
acggttctggccaccggcggtgccggccgtatctacgcatcgaccaccaacgccctgatc
aacaccggtgacggtgtcggcatggcgctgcgcgccggcgtaccggtgcaggacatcgag
atgtggcagttccacccgaccggtatcgctggtgccggtgtgctggtaaccgaaggttgc
cgcggtgaaggtggttacctgatcaacaagcacggcgagcgcttcatggagcgttacgcg
ccgaacgcgaaggacctggctggtcgcgacgtcgtggcacgctcgatggtcaaggaaatc
ctggcgggtaacggctgtggcccggatggcgaccacgtgatgctgaagctggatcacctg
ggcgaggaagtgctgcatagccgcctgccaggtatctgtgagctgtcgaagacctttgct
cacgttgatccggtcgttgcaccggtgccggttgttccgacctgccactacatgatgggt
ggtatcgccaccaacatccatggccaggcgattactcaggacgccaacggcaacgacaag
atcatcgacggtctgttcgcggtgggcgaagtggcctgcgtatccgtacatggcgccaac
cgtctgggtggcaactcgctgctcgacctcgtggtgttcggtcgtgctgccggtctgcac
ctggagaaggcgctgaaggaaggtatcgagcaccgcggtgcgagcgaaaccgacctcgac
gtggccctggctcgtcttgcaggcgtgaacgagcggaccactggcgaagacgttgcgccg
ctgcgcaaagagctgcagaactgcatgcagaactacttcggcgtgttccgtaccggcgag
tacatgcagaagggtatcgctcagctgtcggatctgcgtcagcgcattgccaacgtcaag
atcgccgacaagagccaggcgttcaataccgcgcgtatcgaagcgctcgagctccagaac
ctgctcgaagtggccgaggcgactgccgttgcggctgaggcgcgcaaggagtcccgcggc
gcccatgcccgtgaagatttcgaagagcgtgatgacgagaactggctgtgccacaccctg
tacttccccggcgagaagcgggtaggcaagcgtgccgtgaacttcgctccgaagaccgtt
ccggcattcgagccgaaggtccggacttactga

DBGET integrated database retrieval system