KEGG   Pseudomonas balearica: CL52_08290
Entry
CL52_08290        CDS       T03573                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00010  Glycolysis / Gluconeogenesis
pbm00020  Citrate cycle (TCA cycle)
pbm00260  Glycine, serine and threonine metabolism
pbm00280  Valine, leucine and isoleucine degradation
pbm00310  Lysine degradation
pbm00380  Tryptophan metabolism
pbm00620  Pyruvate metabolism
pbm00630  Glyoxylate and dicarboxylate metabolism
pbm00640  Propanoate metabolism
pbm01100  Metabolic pathways
pbm01110  Biosynthesis of secondary metabolites
pbm01120  Microbial metabolism in diverse environments
pbm01200  Carbon metabolism
Module
pbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL52_08290
   00020 Citrate cycle (TCA cycle)
    CL52_08290
   00620 Pyruvate metabolism
    CL52_08290
   00630 Glyoxylate and dicarboxylate metabolism
    CL52_08290
   00640 Propanoate metabolism
    CL52_08290
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CL52_08290
   00280 Valine, leucine and isoleucine degradation
    CL52_08290
   00310 Lysine degradation
    CL52_08290
   00380 Tryptophan metabolism
    CL52_08290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbm04147]
    CL52_08290
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     CL52_08290
Exosome [BR:pbm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CL52_08290
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 GIDA FAD_oxidored FAD_binding_3 HI0933_like 3HCDH_N AlaDh_PNT_C NAD_binding_8 DAO Thi4 Lycopene_cycl K_oxygenase 2-Hacid_dh_C UDPG_MGDP_dh_N Amino_oxidase XdhC_C Rossmann-like
Other DBs
NCBI-ProteinID: AJE15047
UniProt: A0A1G9RGD7
LinkDB
Position
1773130..1774566
AA seq 478 aa
MSEKFDVIVIGAGPGGYVAAIRAAQLGLKTACIEKYKGKDGKLALGGTCLNVGCIPSKAL
LDSSYKYHEAHASFDVHGISTGEVKMDVPTMVARKDQIVKNLTGGVSALMKANGVTVFEG
HGKLLAGKQVEVTGTDGSVQTLAAENVILASGSTPVNIPPAPVDQKIIVDSTGALDFQTV
PGKLGVIGAGVIGLELGSVWARLGAEVTVIEAMDKFLPAADEQIAKEAFKVLSKQGLNIL
LGARVTGTEIKGDQVTVSYTNAEGEQQQTFDKLIVAVGRRPVTADLLAADSEVTLDERGF
IYVDDQCATNVPGVYAIGDVVRGAMLAHKASEEGVMVAERIAGHKTQMNYELIPSVIYTH
PEIAWVGKSEQALKAEGVEVNVGVFPFAASGRAMAANDTAGLVKVIADAKTDRVLGVHVM
GPAAAELVQQGAIGMEFGTSAEDLGMMVFSHPTMSEALHEAALAVNGHAIHIANRKKR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagcgagaaattcgacgtcatcgtcatcggtgcgggcccaggtggctatgtcgccgct
atccgcgccgcgcagctgggcctgaagactgcctgcatcgaaaagtacaagggcaaggac
ggcaagctcgcgctcggcgggacctgtctgaacgttgggtgcatcccgtccaaggcactg
ctggatagctcctacaagtatcacgaggcgcatgccagtttcgatgttcacggcatctcg
accggcgaggtcaagatggacgtgccgaccatggtcgcgcgcaaggaccagatcgttaag
aacctgaccggcggcgtttcggcgctgatgaaggccaacggcgtgaccgtcttcgaaggc
cacggcaagctgctggccggcaagcaggtcgaagtcacgggtaccgacggcagcgtgcaa
acgctggcggccgagaatgtcatcctcgcctcgggttcgaccccggtgaacattccgccg
gcaccggtggatcagaagatcatcgtcgactctaccggcgccctggacttccaaactgtt
cccggcaagctcggtgtgatcggtgcgggcgtcatcggcctcgaactcggttcggtctgg
gcccgtctgggtgccgaagtcaccgtcatcgaagcaatggacaagttcctgccggcggct
gatgagcagatcgccaaggaagccttcaaggtactgtccaagcagggtctgaacattctg
ctcggcgcgcgcgttaccggcaccgagatcaagggcgaccaggtcaccgtcagctacacc
aacgccgaaggcgagcagcagcagaccttcgacaagctgatcgttgcggtcggccgtcgt
ccggtgactgccgatctgctggctgccgactcggaagttacgctcgacgagcgcggcttc
atctatgtcgacgatcaatgcgcgaccaatgtgccgggtgtatacgctatcggcgacgtg
gtgcgtggcgccatgcttgcgcacaaggcctccgaagagggcgtgatggttgccgagcgc
attgccggtcacaagactcagatgaactacgagctgatcccgtcggtgatctacacgcac
ccggaaatcgcatgggtcggcaagtccgagcaggcgctgaaggccgaaggcgtcgaggtg
aacgtcggcgtattcccgttcgctgccagtggtcgcgccatggccgccaacgataccgcc
ggtctggtcaaggtcatcgccgatgccaagaccgatcgtgttctgggtgtccacgtgatg
gggccggctgccgcggagctggtacagcaaggtgcaatcggcatggaattcggcaccagt
gccgaagatctcggcatgatggtgttctcgcacccgactatgtccgaggccttgcatgag
gctgcgctggcagtaaatggccacgccattcacatcgcgaatcgcaagaagcgctaa

DBGET integrated database retrieval system