KEGG   Pseudomonas balearica: CL52_08895Help
Entry
CL52_08895        CDS       T03573                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00061  Fatty acid biosynthesis
pbm00780  Biotin metabolism
pbm01100  Metabolic pathways
pbm01130  Biosynthesis of antibiotics
pbm01212  Fatty acid metabolism
Module
pbm_M00083  Fatty acid biosynthesis, elongation
pbm_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CL52_08895
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CL52_08895
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CL52_08895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbm01004]
    CL52_08895
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CL52_08895
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CL52_08895
Lipid biosynthesis proteins [BR:pbm01004]
 Fatty acid synthase
  Component type
   CL52_08895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF2102
Motif
Other DBs
NCBI-ProteinID: AJE15158
UniProt: A0A1G9RNX0
LinkDB All DBs
Position
complement(1903390..1904184)
Genome map
AA seq 264 aa AA seqDB search
MGFLTGKRVLIVGVASKLSIASGIAAAMHREGAELAFTYQNEKLKGRVEEFAAGWGSSAD
LCFPCDVANDEDIARVFEELGKKWDGLDCIVHSVGFAPGDQLNGDFTEVTTREGFKIAHD
ISAYSFVALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSL
GPEGTRVNCISAGPIRTLAASGIASFRKMLAANEKQTPLRRNVTIEEVGNAGAFLCSDLA
SGISGEILYVDGGFNTTAMGSLED
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctaaccggtaagcgcgtactgatcgtaggcgtggccagcaaactgtcgatc
gcctccggcatcgccgccgccatgcaccgcgaaggtgccgagctggccttcacctaccag
aacgagaagctcaagggccgcgtcgaagagttcgccgccggctggggctcgagcgccgac
ctgtgtttcccctgtgacgtggccaacgacgaagacatcgcgcgggtcttcgaggagctg
ggcaagaagtgggacggcctggactgcatcgtccactcggttggtttcgccccgggcgac
cagctcaacggtgacttcaccgaagtaaccacccgcgaaggcttcaagatcgcccacgac
atcagcgcctacagcttcgtcgccctggccaaggccggtcgcgaaatgatgaaaggccgc
aacggcagcctgctgaccctttcctacctgggcgccgagcgcaccatgccgaactacaac
gtgatgggcatggccaaggcttcgctggaagccggcgtacgctacctggccggcagcctc
ggcccggaaggcacccgcgtgaactgcatctccgcgggcccgatccgcaccctggccgcc
tccggcatcgccagcttccgcaagatgctggccgccaacgagaagcagaccccgctgcgt
cgcaacgtgaccatcgaagaagtcggcaacgccggcgccttcctctgctcggacctggcc
tcgggcatcagcggcgaaattctctatgtcgacggcggcttcaacaccaccgccatgggc
tcgctggaagactga

DBGET integrated database retrieval system