KEGG   Pseudomonas balearica: CL52_12720
Entry
CL52_12720        CDS       T03573                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00564  Glycerophospholipid metabolism
pbm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CL52_12720 (glpD)
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CL52_12720 (glpD)
SSDB
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 3HCDH_N Pyr_redox FAD_binding_3 GIDA Sod_Cu HI0933_like
Other DBs
NCBI-ProteinID: AJE15853
UniProt: A0A1G9Q7U1
LinkDB
Position
2756002..2757537
AA seq 511 aa
MPHLPQPVSELYDVAVIGGGINGVGIAADAAGRGLSVFLCERDDLASHTSSASSKLIHGG
LRYLEHYEFRLVREALAEREVLLNKAPHIVKPMRFVLPHRPHLRPAWMIRAGLFLYDHLG
TRKRLPASRSLRFGQDSALKPTISRGFEYSDCWVDDARLVVLNAMAAREHGAHIHTRTQC
LSARRAGGIWHVELQRADGSRFALRAKALVNAAGPWVAQFIGENLKQRSPYGIRLIQGSH
IIVPRLFEGEQAYILQNEDRRIVFTIPYLDRYTMIGTTDREYRGDPAQVSISEEEIAYLL
AISNAHFRKQLAAQDILHTFAGVRPLCDDESDNPSAVTRDYTLSLSADPGQAPLLSVFGG
KLTTYRKLAESALAQLKPFFTQMGDSWTASSPLPGAESFGSISELAARLTERVVDITPEL
AHRWATTYGSRVWHMLGDARSRSELGEELGHGLYRAEVDYLLAEEWATQAEDILWRRTKL
GLVCSPEQVAQLQRYLADHPLLQPGRSSDAA
NT seq 1536 nt   +upstreamnt  +downstreamnt
gtgccccatctcccccaacccgtctccgagctctatgacgtcgccgtaatcggcggcgga
atcaacggcgtcggcattgctgccgacgcggccggtcgtgggctttcggtgtttctttgc
gaacgcgatgacctggccagccatacctcttcggccagcagcaagctgatccacggtggc
ctgcgctacctggagcactatgagtttcgtctcgtccgagaggcgctggcagagcgcgag
gtgctgctgaacaaggcgccacacatcgtcaagccgatgcgcttcgtgctgccgcaccgg
ccgcacctccgcccggcctggatgatccgcgccgggctgttcctttacgatcacctcggc
acacgcaagcgactgcccgcctcgcgcagcctgcgcttcggtcaggacagcgcgctgaag
ccgacgatcagccgagggttcgaatattccgattgctgggttgacgatgcacggctggtg
gtgctcaacgccatggctgcacgcgagcacggcgcgcatatccacacccgcacgcaatgc
ctgagcgccaggcgggcgggaggcatctggcatgtcgagctgcagcgcgccgacggcagc
cgtttcgccctacgcgccaaggcgctggtcaatgcggccggcccatgggtcgcacagttc
atcggcgaaaacctgaagcagcgctcgccctatggcatacgcctgatccagggcagccac
atcatcgttccgcgcctgttcgaaggtgaacaggcctacattctgcagaacgaagatcgc
cgcatcgtgttcacgattccctatctggatcgctacaccatgatcggcaccaccgaccgc
gagtaccggggcgacccggcgcaggtcagcatcagcgaagaggagatcgcctacctgctg
gccatttccaacgcgcatttccgcaagcagctggcagcgcaggacatcctgcacaccttt
gccggcgtcaggccgctgtgcgatgacgaatcggacaacccttcggcggtaacccgcgac
tacaccctgtcgctctcggctgacccaggccaggctcccttgctttcggtgttcggcggc
aagctgaccacctaccgcaagctggccgagtccgcgctcgcgcagctcaagccgttcttt
acgcagatgggcgacagctggactgcatcgtcgccattgcccggcgcggagagcttcggc
tcgatcagcgagctggctgcgcggctcaccgagcgagtcgtcgacatcacgccagagctg
gcccaccgctgggccacgacctacggcagtcgcgtctggcacatgctgggcgacgcgcgt
tcacgcagcgagctgggtgaagaacttggccacggcctgtaccgggccgaagtggattac
ctgctcgccgaggaatgggccacacaggccgaggacatcctctggcggcgcaccaagctc
ggcctggtctgcagccccgagcaggtcgcacagctgcagcgttacctggccgatcatccg
ctgctgcaacccggacgcagcagcgacgccgcctga

DBGET integrated database retrieval system