KEGG   Pseudomonas balearica: CL52_14215Help
Entry
CL52_14215        CDS       T03573                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CL52_14215
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CL52_14215
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CL52_14215
    1.1.1.-  
     CL52_14215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: AJE16129
UniProt: A0A1G9QKQ5
LinkDB All DBs
Position
3041814..3042902
Genome map
AA seq 362 aa AA seqDB search
MNSQATMTAAVWHGRKDIRLEQVPLPGAPQPGWVQIRVHWCGICGSDLHEYLAGPVFIPV
DAPHPLTGIKGQCILGHEFCGEIVATGDGVEGYAPGDKVAADACQHCGQCRFCKTGQYNL
CEQLAFTGLMNNGAFAELVNVPAELLYRLPEGFPLEAGALIEPLAVGMHAVKKAGSLLGE
TVVVVGAGTIGLCTIMCAKAAGAGQVIALEMSAARKAKALEVGATRVIDPSECDAIAEIK
AITGGYGADTSFECIGHKATAKLAIDVIRKAGRCVMVGIFEEPSEFNFFEIVATEKQVIG
SLAYAGEFADVIALIADGRMNVTPLITGRIGLDSILEQGFEELANHKDRNVKIIVSPSAL
AG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccaagccaccatgaccgccgccgtctggcacggccgcaaggacatccgcctg
gaacaggtgccgctgcccggcgcgccgcaaccgggctgggtgcagatccgcgtgcactgg
tgcggcatctgcgggtccgacctgcacgaatacctcgccgggccggtgttcattccggtg
gatgcgccgcacccgctcaccggcatcaagggccagtgcatcctcggccacgagttctgc
ggcgagatcgtcgccaccggtgacggcgtcgaaggctacgcgccgggcgacaaggtcgcc
gccgacgcctgccagcactgcggccagtgccgcttctgcaagaccggccagtacaacctc
tgcgaacagctggccttcaccgggctgatgaacaacggcgccttcgccgaactggtcaac
gtccccgccgagctgctctaccgcctgcccgaaggctttccgctggaggccggcgcgctg
atcgaaccgctggcggtcggcatgcacgcggtgaaaaaggccggcagcctgctcggcgag
acggtggtggtggtcggcgccggcaccatcggcctgtgcaccatcatgtgcgccaaggcc
gccggcgccggccaggtgatcgccctggagatgtccgccgcgcgcaaggccaaggcgctg
gaagtcggcgccacgcgggtcatcgaccccagcgagtgcgacgccattgccgagatcaag
gcaatcaccggcggctacggcgccgacacctccttcgaatgcatcggccacaaggccacc
gccaagctcgccatcgacgtgatccgcaaggccggccgctgcgtgatggtgggcatcttc
gaggagccctcggaattcaacttcttcgagatcgtcgccaccgagaaacaggtgatcggc
tcgctcgcctacgccggcgaattcgccgatgtcattgccctgatcgccgacggccgcatg
aacgtcaccccgctgatcaccgggcgcatcgggctggacagcattctcgagcagggcttc
gaggagctggccaaccacaaggaccgcaacgtcaagatcatcgtcagccccagcgcactg
gccggctga

DBGET integrated database retrieval system