KEGG   Pseudomonas balearica: CL52_14630
Entry
CL52_14630        CDS       T03573                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00626  Naphthalene degradation
pbm01100  Metabolic pathways
pbm01120  Microbial metabolism in diverse environments
pbm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CL52_14630
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     CL52_14630
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-ProteinID: AJE16206
UniProt: A0A1G9QPQ7
LinkDB
Position
3130063..3130971
AA seq 302 aa
MSKQPAVIELGYMGISVKDPDAWKSFATNMLGLQVLDEGEKDRFYLRMDYWHHRIVVHHN
GQDDLEYLGWRVSGKPEFEALGQKLIDAGYDVRVCDKAEAQERMVLGLMKTVDPGGNPTE
IFWGPRIDMNNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVEAAHKFYSLLGLRGDVEYRI
PLPNGMTGELTFMHCNGRDHSIGFGAMPAEKRLNHVMLEYTDIEDLGYTHQQFVKNDIDI
ALQLGIHANDKALTFYGATPSGWLIEPGWRGAKAIDEAEYYVGDIFGHGIETTGYGMDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagtaagcaacctgcagttattgaactcggatacatgggcatctcggtcaaggatcct
gatgcgtggaaatcattcgccacgaatatgctgggcctgcaagttcttgatgaaggtgag
aaggaccgtttctatctacgtatggattactggcatcatcgaatcgtggtccatcataac
ggccaggacgacctggaatacctgggctggcgtgtgtccggaaaaccggagttcgaggct
ctcggtcaaaaactcattgacgccggttacgatgttcgcgtctgcgataaagccgaggct
caggaacgaatggtgttgggcctgatgaagacagtagatccaggcggcaacccgaccgag
atattctggggcccccggatcgacatgaacaacccgttccatcccggccgccccctgcac
ggcaagtttgtgactggtgaccaaggcctgggtcattgcatcgttcgccagaccgatgtc
gaagctgcccacaagttctatagtcttctgggcttgcgtggggacgtcgaataccggatc
ccgctgcccaacggcatgactggcgaactaacgttcatgcattgcaatggtcgggaccac
tccattgggtttggtgccatgcccgctgaaaagaggctcaatcatgtgatgcttgagtac
accgacatagaggatctgggatacacccatcaacagtttgtaaagaacgacattgacatt
gccttgcaacttggcattcatgctaacgacaaggcgctgacgttctatggcgcaacacct
tccggctggctcattgagcccggctggcgaggtgccaaggccatagacgaagcggagtac
tacgttggagacatctttggccatggtatcgagaccactggctacggcatggatgtaaaa
ttgagttaa

DBGET integrated database retrieval system