KEGG   Pseudomonas balearica: CL52_14860
Entry
CL52_14860        CDS       T03573                                 

Definition
(GenBank) conjugal transfer protein
Organism
pbm  Pseudomonas balearica
SSDB
Motif
Pfam: DUF3487 TraL PrgI LapA_dom
Other DBs
NCBI-ProteinID: AJE16248
UniProt: A0A1G9QTG5
LinkDB
Position
complement(3180244..3180654)
AA seq 136 aa
MAVPSETPRDTLVTFLPHRLNRQPVVVRGLTADELWICAGLSAAAGFALGLPLAWLTHTI
AMVPTLIVAGIALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRHPALAALLGGQRLIT
RSGYWTTRRNADRGAP
NT seq 411 nt   +upstreamnt  +downstreamnt
atggccgtcccttcggagaccccgcgcgacacgctggtgaccttcctgcctcaccggctg
aaccgccagcccgtggtcgtgcgcgggctgaccgccgacgagttgtggatctgcgccggc
ctgtcggccgcagccgggttcgcgctcggcctgccgctggcctggctcacgcacaccatc
gccatggtgcccaccctgatcgtcgccggcatcgcgctgggcgtcttcgtcggcggcggc
ttcctgcgcgcgcagaagcgcggccggcccgacacctggctgtaccggcagctccagtgg
cggctggcattgcggcacccggcgctggcagcgctcctgggcggccagcgcctcatcacc
cgctcgggctattggacgacccggcgcaacgccgatcgaggtgcgccatga

DBGET integrated database retrieval system