KEGG   Pseudomonas balearica: CL52_16290
Entry
CL52_16290        CDS       T03573                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00970  Aminoacyl-tRNA biosynthesis
pbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CL52_16290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pbm03029]
    CL52_16290
Enzymes [BR:pbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CL52_16290
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CL52_16290
Mitochondrial biogenesis [BR:pbm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CL52_16290
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AJE16522
UniProt: A0A1G9W8J2
LinkDB
Position
3461680..3463131
AA seq 483 aa
MHQLSLAEIARGLNERQFSAEELTRGLLDRIARLDPQINSFITVTEELALAQARAADARR
AAGENDALLGAPIAHKDLFCTKGIRTSCGSKMLDNFAAPYDASVVEKLAAAGAVTLGKTN
LDEFAMGSANESSHYGAVKNPWDLSRVPGGSSGGSAAAIAARLVPAATGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMIAYASSLDQGGPMARSAEDCALLLGSMAGFDPKDSTSVDQ
PLDDYLAALGRPLTGLRIGLPKEYFGEGLDPKIASAVLAVVEELKKLGATVKDISLPNTQ
HAIPSYYVIAPAEASSNLSRFDGVRFGYRCENPADLTDLYKRSRAEGFGDEVKRRIMVGT
YALSAGYYDAYYIKAQQIRRLVKNDFVSAFEEVDVILGPTTPNLAWKLGEKNADPVSAYL
EDIYTITANLAGIPGLSMPAGFIDGLPVGVQLLAPYFQEARLLNVAHQYQQVTDWHTRAP
AGF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcaccaactgagccttgccgagatcgctcgcggcctgaacgagcgacagttctccgcc
gaggagctgacccgcggtctgctggaccgcatcgcccgcctcgatccgcagatcaacagc
ttcattaccgtcaccgaggaactggctctggcacaggcccgcgcggccgacgcccgccgc
gctgccggcgagaatgacgccctgctcggcgcgcccatcgcgcacaaggacctgttctgc
accaagggcatccgcaccagctgcggctcgaagatgctcgacaacttcgccgcaccctac
gacgccagcgtggtcgagaagctcgcagccgctggtgcggtcaccctgggcaagaccaac
ctggacgagttcgccatgggctcagccaacgagtccagtcattacggcgcagtgaagaac
ccctgggacctgtcgcgtgtaccgggcggttcgtccggcggttcggccgccgcgattgcc
gcgcgcctggtgcccgccgccaccggcaccgacaccggcggctcgatacgccagcccgcc
gcgctgaccaacctcaccggcctcaagcccacctatggccgcgtttcgcgctggggcatg
atcgcctacgcgtcgagtctcgaccagggcggcccgatggcgcgcagcgccgaggactgc
gccctgctgctcggcagcatggccggtttcgatccgaaggattcgaccagtgtcgatcag
ccgctcgacgactatctggccgcgctgggccggccgctgaccgggctgcgcatcggcctg
ccgaaggagtacttcggcgagggcctggacccgaagatcgccagcgcagtgctggccgta
gtcgaggaactgaagaagctcggcgccacggtcaaggacatcagcctgccgaacacgcag
cacgcgatcccttcctattatgtgatcgccccggccgaggccagctccaacctgtcgcgc
ttcgatggcgtgcgtttcggctaccgctgcgagaacccggcggacctcaccgacctctac
aagcgctcgcgcgccgagggcttcggcgacgaggtcaagcgccgcatcatggtcggcacc
tacgccctctcagccggctactacgacgcctactacatcaaggcacagcagatccgccga
ctggtcaagaacgacttcgtcagcgcctttgaggaagtcgacgtgatcctcgggccgacc
accccgaacctggcctggaagctcggtgagaaaaacgccgacccggtctcggcctatctc
gaagacatctacaccatcaccgccaacctggcgggcattcccggcctgtcgatgccggcc
ggcttcatcgacggcctgcccgtcggcgtgcagctgctggcgccgtacttccaggaggcc
cgcctgctcaacgtcgcgcaccagtaccagcaggtcaccgactggcacacccgcgctccg
gccggattctga

DBGET integrated database retrieval system