KEGG   Pseudomonas balearica: CL52_17010
Entry
CL52_17010        CDS       T03573                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CL52_17010
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     CL52_17010
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 DAO FAD_binding_2 NAD_binding_8 FAD_binding_3 HI0933_like Thi4 Pyr_redox FAD_oxidored Lycopene_cycl Trp_halogenase GIDA
Other DBs
NCBI-ProteinID: AJE16653
UniProt: A0A1G9VM81
LinkDB
Position
3604987..3605934
AA seq 315 aa
MNLPDHPGQRADVDCLIVGGGPAGLTAALYLARFRRSCRVVDAGCSRAALIPRSHNYPGF
PPGISGRELLARLREQAQGYGAQLQDGRVDSLERHALGFRVGYAGQSCIARRVILATGIE
DTLPEMPDAQAAIARGALRLCAICDGYEVDGHDVAVYGDAECAIGHAAFLRTFSDRVTVI
APGGDRAARDAALALANHHDIHLLFDGIERLQPRDGGIEVTTLAGQVHRFDILYPCLGAR
FRSDLALGIGVACDDSGAVLVDAHQQTSVPGLYALGDVVPGLKQMSVAVGHAAQGATAVH
NSLEANPWGGSAASR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaacctgccagatcaccccggccagcgcgccgacgtcgactgcctgatcgtcggcggc
ggcccagccggcctcaccgccgcgctctatctcgcgcgtttccgccgctcgtgccgggtc
gtcgatgccggctgcagccgcgcggcgctgatcccccgctcgcacaactaccccggcttt
ccgccgggcatctccggccgcgagctgctggcccgcctgcgcgagcaggcgcagggctat
ggcgcgcagctgcaggacggccgggtcgactcgctcgagcgccacgcactgggctttcgt
gtcggctacgccgggcaaagctgcatcgcccgccgggtgatcctggccaccggcatcgag
gacaccctgccggagatgcccgatgcccaggcggcgattgcccgcggggcgctgcgcctg
tgtgcgatctgcgacgggtacgaggtcgacggccatgacgtggcggtgtacggcgacgcc
gaatgcgcgatcggccacgcggcgttcctgcgcaccttcagcgaccgcgtcacggtgatc
gccccgggcggcgaccgcgcggcccgcgacgctgcgctggcgctggcgaaccaccacgac
atccacctgctgttcgatggcatcgagcggctgcaaccccgcgacggcggcatcgaggtc
accacgctggccggccaggtgcatcgcttcgacattctctacccctgcctgggtgcgcgt
tttcgctccgacctcgcgctggggatcggcgtcgcctgcgatgacagcggcgcagtgctg
gtcgacgcccatcagcagacctccgtgcccggcctctatgcgctgggcgacgtggtgccg
gggctcaaacagatgagcgtcgcggtcggccacgccgcacagggtgcaaccgccgtgcac
aacagtctcgaggccaacccctggggcggcagcgcggccagccgatga

DBGET integrated database retrieval system