KEGG   Pseudomonas balearica: CL52_18200Help
Entry
CL52_18200        CDS       T03573                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00550  Peptidoglycan biosynthesis
pbm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CL52_18200
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CL52_18200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pbm01011]
    CL52_18200
Enzymes [BR:pbm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CL52_18200
Peptidoglycan biosynthesis and degradation proteins [BR:pbm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CL52_18200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJE16873
UniProt: A0A1G9UQS6
LinkDB All DBs
Position
complement(3840270..3842159)
Genome map
AA seq 629 aa AA seqDB search
MPQPIQLKDHEKDALLVRRRIIVGALVVLLLSGVLVARMYFLQVIQFDYHSTLSENNRVH
VQPIPPSRGLIYDRNGRVIADNRPSFSLTVTRERAGEWREVLDRVVEVLELGAEERELFE
KRVLQGRRPFEPVPIMYELSEEQIARIAVNQFRLPGIEVAAQLVRHYPQGAHFAHSVGYV
GRINEKELQSLDPVNYAGTHHIGKTGIEKFYEDVLHGQVGYEEVETNARGRVLRVLKRTD
PVPGKDITLTLDLKLQEAAEAALAGRRGAIVALLPKTGEVVAMVSQPSFDPNLFVTGISF
KDYGALRDSIDRPLYNRVLRGLYPPGSTIKPMMAIAGLDAGVITPTSRVYDPGYYQLPNV
KHKYRNWNRGGDGSVDLELAIMRSNDTYFYDMAHKLGVDRMHDYMSRFGLGQRVALDMYE
ETAGLMPSREWKRSRYRQPWYPGETVILGIGQGYMQATPLQLAQATALMATRGKWIRPHL
ARRIGGEPPVDPDPMPDIELRDPKFWDYSIHGMEQVLHGPRGTAKKVGDSAAYRIAGKSG
TAQVVAIKQGEKYDSSRLAERHRDHALFVAFAPVQDPEIAVAVMVENGESGSGVAAPVAK
AVLDAWLLDDSGQLKAEYAPAAKAEGEKS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccgattcagctcaaggatcacgaaaaagacgcactgctggtccgccgccgg
atcatcgtcggcgcgctcgtcgtgctgctgctgtccggtgtgctggtggcacggatgtac
tttcttcaggtcatccagttcgactaccactccacgctgtcggaaaacaaccgcgtccat
gtgcagccgattccgccgagccgtgggctgatctacgatcgcaacgggcgggtgatcgcc
gacaaccggccgagcttcagcctgactgtcacccgcgagcgcgccggcgaatggcgggaa
gtcctcgaccgcgtggtagaggtgctcgagctcggcgccgaagagcgtgagctgttcgag
aagcgtgtcctgcaggggcggcggccgttcgagccggtgccgatcatgtacgagctgagc
gaggaacagatcgcgcggatcgcggtgaatcagttccgcctgccgggcatcgaggtcgcc
gcccagctcgtccgccactacccgcagggtgcgcatttcgcgcactcggtgggctatgtc
gggcgaatcaacgaaaaggaactgcagagcctggatccggtgaactacgccggcacccat
cacatcggcaagaccggcatcgagaaattctacgaggacgtgctgcacggccaggttggc
tacgaagaggtggagaccaacgcgcgcggtcgcgtgctgcgcgtgctcaagcgcaccgac
ccggtgcccggcaaggacatcacgctgaccctcgacctgaaactgcaggaggctgccgag
gcggcactggccgggcgtcgcggtgcgatcgtggcgctgctgccgaagaccggcgaggtg
gttgcgatggtcagccagccgagcttcgatcccaacctctttgtcaccggcatcagcttc
aaggactacggtgcgctgcgcgactcgatcgaccgcccgctgtacaaccgcgtgctgcgc
gggctctatccgccgggttcgacgatcaagccgatgatggcgatcgccgggctggatgcc
ggggtgatcacgccgaccagccgcgtctacgacccgggctactaccagttgccgaacgtc
aagcacaagtaccgcaactggaaccgcggcggcgacggctcggtggacctggagctggcg
atcatgcgttccaacgacacctacttctacgacatggcgcataagcttggggtcgatcgc
atgcatgattacatgtcgcgcttcggcctggggcagcgcgtggcgctggacatgtacgag
gaaaccgccggcctgatgccttcgcgcgagtggaagcgcagccgttaccggcagccgtgg
tacccaggcgaaacggtcattctcggcatcggccagggctacatgcaggccacgccgttg
caactggcccaggccacggcgctgatggctacccgcggcaagtggattcgtccgcatctg
gcccggcgcattggtggcgagccgccagtggatccggatccgatgccggatatcgagctg
cgcgatccgaagttctgggactactcgatccacggcatggagcaggtgctgcacggcccg
cgtggtaccgcgaagaaggttggcgatagcgctgcctaccgcattgccggcaagagtggc
acggcgcaggtggtggcgatcaagcagggcgagaagtacgacagctcgcggctggccgag
cggcatcgcgaccatgcgctgttcgttgccttcgccccggtccaggaccccgagatcgcc
gtggcggtgatggtcgagaatggcgaatccggctcgggcgtggccgccccggtcgccaag
gcggtgctcgacgcctggctgctcgacgacagtggtcagctgaaggcggaatacgcgcct
gcggccaaggcagaaggcgaaaaatcatga

DBGET integrated database retrieval system