KEGG   Pseudomonas balearica: CL52_20085
Entry
CL52_20085        CDS       T03573                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00230  Purine metabolism
pbm00240  Pyrimidine metabolism
pbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CL52_20085
   00240 Pyrimidine metabolism
    CL52_20085
Enzymes [BR:pbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     CL52_20085
    3.2.2.-  
     CL52_20085
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AJE17235
UniProt: A0A1G9WPE5
LinkDB
Position
complement(4268908..4270281)
AA seq 457 aa
MTQRHVINASVNPRGSLETLSQREVQQLSEIGSGRAHELFRQCALAILNTGTRIDNAKTI
LEAYADFEVQILQQDRGVRLELFNAPADAFVDGEMIASTREMLFSALRDIVYTESELGSM
RIDLDSSQGITDYVFHLLRNARTLRPGVEPNMVVCWGGHSISTEEYKYSKRVGHELGLRK
LDVCTGCGPGVMKGPMKGATIGHAKQRLVGSRYLGLTEPGIIAAEAPNPIVNELVILPDI
EKRLEAFVRVGHGIIIFPGGVGTAEEFLYLLGILLHPANAELPFPVVLTGPRSAAAYLQQ
LHAFVGATLGEQAQARYRIVIDDPAEVARQMVDGLTAVRRFRRERNDAFHFNWLLKIEEG
FQRPFDPTHEAMAGLQLRRDLPPHELAANLRRAFSGIVAGNVKDKGIRRIEQYGRYEIHG
DAQIMQPLDQLLQAFVEQHRMKLPGGVPYEPCYRVVS
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgacccaacgccatgtcatcaacgcctcggtcaacccccgtggcagcctggaaaccctc
tcccaacgcgaagtccagcagctctccgagatcggctccggccgcgcccacgagctgttc
cgccagtgcgcgctggcgatcctcaacaccggcacgcgcatcgacaacgccaagaccatc
ctcgaggcctacgctgacttcgaggtgcagatcctgcagcaggaccgcggcgtgcgcctg
gagctgttcaacgcaccggccgacgccttcgtcgacggcgagatgatcgccagcacccgc
gaaatgctgttcagcgcgctgcgcgacatcgtctacaccgagagcgaactgggcagcatg
cgcatcgacctggatagctcccagggcatcaccgactacgtctttcacctgctgcgcaac
gcgcgcacgctgcgcccaggcgtcgagccgaacatggtggtgtgctggggcggccactcg
atcagcacagaggagtacaagtacagcaagcgcgtcggccacgagctgggcctgcgcaag
ctggacgtctgcaccggctgcggcccgggcgtgatgaaagggccgatgaagggcgccacc
atcggccatgccaagcagcgcctggtcggcagccgctacctgggcctgaccgagccgggc
atcatcgccgccgaggcgccgaacccgatcgtcaacgagctggtgatcctgccggacatc
gagaaacgcctggaggccttcgtccgcgtcgggcacggcatcatcatctttcccggcggt
gtcggcacggcggaagaatttctctacctgctcggcatcctgttgcatccggccaatgcc
gaactgccgttcccggtggtgctcaccggcccgcgcagtgccgcggcctacctgcagcaa
ctgcacgcgttcgtcggcgccacgctcggcgagcaggcccaggcgcgctatcggatcgtt
atcgacgatccggccgaggtcgcccggcagatggtcgatggcctgaccgccgtgcgccgc
ttccgccgcgagcgcaatgacgcgtttcacttcaactggttgctcaagatcgaggaaggc
ttccagcgccccttcgatccgacccacgaagcgatggccggcctgcagctgcgccgcgat
ctgccgccgcacgagctggcggccaatctgcgtcgggcgttctccggcatcgtcgcgggc
aacgtcaaggacaagggcatccgccgcatcgagcagtacggccgctacgagatccatggc
gatgcgcagatcatgcagccgctggaccagctactgcaggccttcgtcgagcagcaccgc
atgaagctgcccggcggcgtgccctacgagccttgctaccgcgtggtgagctga

DBGET integrated database retrieval system