KEGG   Pseudomonas balearica: CL52_20615
Entry
CL52_20615        CDS       T03573                                 

Gene name
gidA
Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification protein
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
pbm  Pseudomonas balearica
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pbm03016]
    CL52_20615 (gidA)
   03036 Chromosome and associated proteins [BR:pbm03036]
    CL52_20615 (gidA)
Transfer RNA biogenesis [BR:pbm03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    CL52_20615 (gidA)
 Prokaryotic type
    CL52_20615 (gidA)
Chromosome and associated proteins [BR:pbm03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    CL52_20615 (gidA)
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored Pyr_redox_2 FAD_binding_2 AlaDh_PNT_C HI0933_like DAO Pyr_redox Thi4 Pyr_redox_3 FAD_binding_3 NAD_binding_9
Other DBs
NCBI-ProteinID: AJE17330
UniProt: A0A1G9XBQ7
LinkDB
Position
complement(4377231..4379123)
AA seq 630 aa
MDFPSRFDVIVIGGGHAGTEAALAAARMGVKTLLLTHNVETLGQMSCNPAIGGIGKSHLV
KEIDALGGAMATATDKGGIQFRILNSRKGPAVRATRAQADRILYKAAVREILENQTNLWI
FQQAADDLVVEQDQVKGVVTQMGLRFLADNVVLTTGTFLGGLIHIGLQNYSGGRAGDPPS
LALARRLRELPLRVGRLKTGTPPRIDGRSVDFSQMTEQPGDTPLPVMSFLGSREQHPPQV
SCWITHTNARTHEIIASNLDRSPMYSGVIEGIGPRYCPSIEDKIHRFADKDSHQVFLEPE
GLTTHELYPNGISTSLPFDVQLEIVRSIRGMENAHIVRPGYAIEYDFFDPRDLKYSLETK
VIGGLFFAGQINGTTGYEEAGAQGLLAGANAALRAQGREAWCPRRDEAYLGVLVDDLITL
GTQEPYRMFTSRAEYRLILREDNADLRLTEKGRELGLVDDTRWAAFCAKREGIEREEQRL
KSTWVRPGSAEGTAIAERFGSPLVREYNLLNLLARPEIDYASLIELTGDAGADPQVAEQV
EISTKYAGYIERQRDEIERLRASENIALPVDLDYPSISGLSKEIQHKLSQARPQTLGQAS
RIPGVTPAAVSLLMIHLKKRGAGQQLEQSA
NT seq 1893 nt   +upstreamnt  +downstreamnt
gtggatttcccttcccggttcgacgtgatcgtcataggcggtggccatgccggcaccgag
gcagccctggccgctgcgcgcatgggcgtgaagaccctgctgttgacgcacaacgtcgag
acactcggacagatgagctgcaaccccgcgatcggcggtatcggcaagagtcatctggtc
aaggaaatcgatgcgctcggcggcgccatggcgacagccaccgacaagggcggtatccag
ttccgcatcctcaacagccgcaagggcccggctgtgcgcgccacgcgtgcgcaggccgat
cggatcctgtacaaggctgccgtgcgggaaatcctggaaaaccagaccaacctgtggata
tttcagcaggcggcggacgacctggttgtcgagcaggaccaggtcaagggtgtcgtgaca
cagatgggcctgcgtttcctcgcggacaacgttgttctgacgaccgggacctttctcggc
ggacttatccacatcgggttgcagaactattcgggaggacgcgccggtgatcccccttcg
ctcgccctggcacgtcgcttgcgggagctgccgctgcgtgtcggtcgtttgaagaccggt
acaccaccgcgcatcgacgggcgcagcgtggatttttcgcagatgaccgagcagccgggc
gacacgccactaccggtgatgtcgttcctcggctcgcgcgagcagcatccgccgcaggtc
agctgctggatcacccataccaacgcgcgcacccacgagatcatcgccagcaacctggat
cggtcgcccatgtattccggggtgatcgaaggcattggcccgcgttattgcccatcgatc
gaagacaagatccatcgcttcgccgacaaggacagccatcaggttttcctcgaacccgaa
ggactgacgacgcacgagctgtatcccaatggcatctccacttcgctgccgttcgacgtg
cagcttgagatcgtccgcagcattcgtggcatggagaacgcgcatatcgttcgtccgggc
tacgccatcgaatatgactttttcgatccgcgagacctgaagtacagcctggaaaccaag
gtcattggcgggcttttcttcgccgggcagatcaatggcaccaccggctacgaagaggct
ggcgctcaggggctgctggccggtgccaatgcagcgctgcgggcgcaggggcgtgaagcc
tggtgcccgcgtcgtgacgaggcctacctcggtgtgctggtcgatgacctgatcacgctc
ggcacgcaagagccctatcgcatgttcacctcgcgcgccgagtaccgcctgatcctgcgc
gaggacaatgccgatctgcgcctgaccgaaaagggacgcgaactgggtctcgtggatgac
acccgctgggcggcgttctgcgccaagcgcgaaggcatcgagcgtgaggagcagcgactg
aagagcacttgggtgcggcccggcagcgcggagggcaccgcgatcgccgagcgtttcggt
agccccctggtgcgtgagtacaacctgctcaacctgctggcgcggccggaaatcgactac
gccagcctcatcgaactgaccggcgatgccggcgccgatccgcaggtggccgagcaggtg
gagatcagcaccaagtacgccggctacatcgagcgccagcgcgacgagatcgagcgtttg
cgcgccagcgagaacatcgcactgccggtcgacctggactacccctcgatctccggcctg
tcgaaggaaatccagcacaagctttcgcaggcccgcccgcagacgctgggccaggcctcg
cgtatcccaggggtgaccccggcggcagtttcactgctgatgatccacctgaaaaagcgt
ggtgccggacaacagctggagcagagcgcgtga

DBGET integrated database retrieval system