KEGG   Paracoccidioides brasiliensis Pb18: PADG_01715Help
Entry
PADG_01715        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00500  Starch and sucrose metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PADG_01715
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PADG_01715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 22581328
NCBI-ProteinID: XP_010757041
UniProt: C1G449
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MLAFFLCAVWVLSLFRVVQAQSQNPLGLKATGSLDAWIAKESPYALQALLANIGADGAKA
KGAAAGIVIASPSKSDPDYFFTWTRDAALVFKGLVDDFISGNTGLQPKLHEFINSQARLQ
TVSNPSGGLSSGGPGEPKFHVDMSPFNGDWGRPQRDGPALRATAMISYARWLVANGYSDT
AKSIVWPVVQNDLSYVSQFWSFSGYDLWEEINSVSFFTTAVQHRALVEGARLARQLGLTC
PNCESQAPQILCSLQNYWTGSYINSNTGGGRSGKDTNSILASIHTFDPEAACDDTTFQPC
SAKSLANHKVVTDAFRSIYALNSGIPAGSAVSVGRYPEDLYYGGNPWYLSTFAAAEQLYD
AIYQWQKIGSISITNVSLPFFRDVYGSAMIGTYSSSSSAFKSIIEAVRNYADGFLAISQK
YTPESGALAEQFSRDTGTPLSAGDLTWSYASFLTAIARRSSIVPDPWGETEANGIPKTCQ
ATSAIGPYITATNTNWPLNLTPIKRTATPTSTSTASTTSSFPCVTPGSVNVTFNQIATTL
FGQTILLVGSIPELGSWAPGSAIALSADQYTDANHLWYKTITLSAGQKFEYKYIRKETGG
DIVWEGGSNRLYTVPRGCNIYTARREDNWRSQWAFYTEETQTWHARKD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccttttttctttgcgctgtttgggtgctctcgttgttccgggtggtgcaggct
caatcccaaaatccacttgggttaaaagccactggctcattagatgcgtggattgcaaag
gaaagcccgtatgccctacaggcactcctagccaatattggagcagatggtgcaaaggca
aaaggtgcagctgctggcattgtcattgcaagccctagcaaaagtgaccctgattacttt
tttacttggactcgagatgctgccttagtattcaaaggtcttgtggatgactttatttcc
gggaacactggtcttcaaccgaaacttcatgaatttatcaactcgcaagctcgccttcag
acagtgtctaatccttcgggagggctctcatcgggtggccctggtgaacctaaatttcat
gtcgacatgtcaccgttcaatggcgactggggtcgaccccaaagagatggacctgccttg
agggcaactgctatgatttcttatgcgagatggctcgttgcaaatgggtactctgatact
gcgaaatcgatagtttggcctgtggtccagaacgacctttcttatgtgagccagttctgg
agcttttctggctatgatctctgggaggagataaacagcgtgtccttttttacaacagcg
gtgcagcatcgcgctcttgttgaaggcgctagacttgcacgtcagttaggactcacctgc
ccgaactgcgaatcccaagctcctcagattctctgttctctgcagaattactggacgggt
tcctatatcaattccaataccggcggtggtaggtctggtaaagacactaactctattctc
gcaagcattcacacatttgaccctgaggctgcttgtgatgacacgactttccaaccttgt
tccgctaaatcactggcaaaccataaggtggtaacagatgctttccgttctatatatgct
ttgaattctggtatcccagcaggttcagccgtttcagtcggtcgatatcctgaagatctc
tactatggcggtaacccctggtatctgagtacctttgccgcagcggagcagttgtatgat
gcaatttaccagtggcaaaagattggttcgatttcgattaccaatgtgtcacttcctttc
tttagagatgtttatggttctgccatgattggaacttattcgtcttccagttcagctttc
aagtcgataatagaggctgtaagaaattatgcagatggattcctagctatttcgcaaaaa
tacaccccagagtctggtgctctggccgagcaattctcccgggacactgggacccctctg
tcagcaggtgatttgacatggtcatacgcctcgttccttacggctattgcccgacgtagt
tcaattgtcccagatccttggggagagaccgaagctaacggcatcccgaaaacttgtcaa
gctacgtcagcgatcgggccttacatcacggcaactaatactaattggccgttgaacctc
acacctatcaagagaacggcgacgcccacatctacttccaccgcttccaccacatcatca
tttccatgcgtcacccctggctctgtcaatgtgacattcaatcaaatcgctacaacttta
tttggccagacgattctccttgtcggctccattccagaactcgggtcctgggcacctgga
tctgcaattgccctctctgcggaccagtataccgatgccaaccacttgtggtataaaact
attacattgagtgcaggccaaaagttcgaatataagtatattcgtaaggagacgggcggt
gatatcgtgtgggagggtggctccaaccgcctctataccgtaccgcgtggatgtaatatt
tatacggcaaggagggaagacaattggcgttcgcaatgggcattttatacagaagagacg
caaacatggcatgctaggaaagattga

DBGET integrated database retrieval system