KEGG   Paracoccidioides brasiliensis Pb18: PADG_01775Help
Entry
PADG_01775        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
Organism
pbn  Paracoccidioides brasiliensis Pb18
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 Glutaredoxin GST_C
Motif
Other DBs
NCBI-GeneID: 22581374
NCBI-ProteinID: XP_010757068
UniProt: C1G4A9
LinkDB All DBs
Position
Unknown
AA seq 654 aa AA seqDB search
MENPEAQLQHSLRSLAATEDIRSLPTDPSLTSRISAHFEAAAAAAAATGGPQPFAVLQAT
TTGTTAAGTHLQHSPHAERLIDNSVNPPSLPPHQQQLSHAHHQHQFHTPNNNGFLDHRNN
GQVDMLQQLQTPLPAHLLNQFHSTSPNIEAANHSDQSPSPASAHNRGEGHFKNMKLIPNP
PDLKRWRERLFNVDDDPIVMSEEEFQTYFPHVDNVYSHRSTQKYKRKLFVSHYWDCRLKG
RPPGTPKSRDPNKKKRKRTARERDLCDVKIKITEYFPGALAVPPNLLGLDAMSSLEQNMQ
NAAAAVATGTDFLDPVVAGQNELSRVANSNNPQPQAEPHYQFGVLTLRKTLPQGHPGYTG
EKYYTIQRVNGNGGNGRADGIGGPHRHTLEESDRVKKNSVQRHMLKVEKERRKTMAHQKT
YHKKASGLAATTVKKHAKEADLKLFGSCFCPFVQRVWIALEVKGIPYQYIEIDPYKKPDS
LLEMNPRGLVPAIRHGNWECYESTVLLEYLDDLDTGNLLLPSRDPQLRAHCRLWADHINR
HIIPTFYRLLQEQDLQKQIQHSEELKEEISKLVNASHMHGPFFLGPTISFVDIQFAPWIL
RLSRVLKPYRGWPDPEKGSRWAAWVDAIEADERVRATTSADDLYLDSYERYAGK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccccgaggcacagctgcaacacagcttgcgcagtctcgccgccaccgaagac
atacggtcccttccaacagaccccagtttaacctcaagaatcagcgcccacttcgaagca
gcagcagcagctgctgctgccacgggcggaccccagccctttgcagtgctgcaggcgacg
acaacaggaactacagcagcgggaactcatttgcaacattccccgcatgctgagcggctc
atcgacaactcagttaaccctccatcactaccgccgcaccaacaacagttatcgcacgca
catcaccagcatcaattccacacgccaaacaataatggttttctcgatcacagaaataat
ggccaggtcgatatgctgcagcagctgcagactcctctcccggcgcatctcctgaaccaa
ttccacagcacctcgcctaatatcgaagctgccaatcactcagaccaatcgccttcgcct
gcttccgcccataacagaggagagggccactttaaaaatatgaaattgataccaaatcct
cccgatctaaagagatggagggagcgattatttaacgtggatgatgatccaattgtgatg
agcgaagaagaattccaaacttacttcccccatgttgacaacgtctattcccaccgctcc
acccagaaatacaaacgcaagctcttcgtctcgcactactgggactgtcgcctcaagggc
cgcccaccaggaaccccaaaatcccgtgatccaaacaagaagaagcgcaaacgcacagcc
cgcgagcgcgatttatgtgacgtcaaaatcaagattacagagtatttccccggagccctg
gctgtgcctccaaacctgctgggtctggatgccatgtcctccttggagcaaaatatgcaa
aatgctgccgctgccgttgctactggtaccgatttcctcgaccccgttgttgctggccag
aatgaactatcgcgtgttgccaatagtaataatccacagccacaagcagagcctcactat
cagtttggcgtcctgacgttgcggaagacgctacctcagggccaccctggctataccggt
gagaagtactatacaatccagagggttaatgggaatggggggaatgggagggcagacggc
attggtgggccccataggcatacactggaggaaagcgacagggttaagaagaatagcgtg
cagcgtcatatgcttaaggtggagaaggagaggaggaaaactatggcccaccagaaaacc
tatcacaaaaaggcctctggccttgccgccacaactgtcaaaaagcacgctaaggaagca
gatttgaagctctttgggagttgtttctgtccgttcgtccagcgtgtttggatagcgttg
gaggtcaaggggatcccataccagtatatcgagattgatccgtacaagaagcccgattcg
ttactggaaatgaatccacgtggtttggtgcctgccatccggcatgggaactgggaatgc
tatgagagcacagttttgctggaatatctcgatgaccttgataccggtaatcttctactc
ccgtcgagagatcctcaactacgcgctcattgccgtttatgggcagatcacataaaccgc
cacataatccccaccttctaccgcctcctgcaagagcaggacctgcaaaagcaaatccag
cactcagaagagttgaaggaagaaattagcaagcttgttaatgcctcgcacatgcacggg
ccgttcttcctcggcccgacaatctcctttgtagatatccaatttgcgccctggatacta
cggctcagccgcgtgctgaaaccgtatcggggctggccggatcctgagaaagggagtcgc
tgggctgcatgggtggatgctatcgaggctgatgaacgtgtcagggccacgacgagcgcg
gatgacctgtatttggatagttatgagaggtatgctggtaagtaa

DBGET integrated database retrieval system