KEGG   Paracoccidioides brasiliensis Pb18: PADG_02018Help
Entry
PADG_02018        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
Organism
pbn  Paracoccidioides brasiliensis Pb18
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-GeneID: 22581574
NCBI-ProteinID: XP_010757165
UniProt: C1G502
LinkDB All DBs
Position
Unknown
AA seq 322 aa AA seqDB search
MKAARFYAAGDIRVEDVDPPRATNDKVLVEVEWCGICGSDLNEYVRGPYAIPDEKNGPHH
ITGEMLPVTLGHEFSGRVVRAPPTSSLVPGQPVAIDPRFFCSSCPACKETATNCCRHVGS
LGLSGGGGGLSEMVSVHPAMLHPLPEGTDLAAAALIEPLAVAWRAVKRRPIGVATVFVLK
AEGCDMILVSEKAARRREFLADVVHAAFDPTEVNICGEMQGTHGRSWGGNRCMALISIWQ
FQKLQYEHFLLKELTFKTFLAYDETDFKEVVAAFGSGRFAGVEKMITRRISLDEIVEKGF
KELTENPGDHIKIIASPKIRLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttctatgctgcaggagatatccgtgttgaggatgtggacccgccg
cgagcaactaatgataaggttctggtggaagtagaatggtgtggaatttgcggaagcgac
ctcaatgaatatgttcgaggaccctacgcaatccctgacgaaaagaacggacctcatcat
attactggcgagatgttgccagtcacattgggtcatgagttctccggacgagtcgttcgg
gcaccacctacatcctctctcgtcccagggcagccagtagccattgatccgcggttcttc
tgctcatcttgccctgcatgtaaggagacggcaacgaactgctgcagacatgtgggatct
ctgggtctgtctgggggaggagggggcctttctgaaatggtttctgttcacccggccatg
ctccatccgcttccggaagggactgacctggctgcagcagcattgatcgagcccctggcg
gttgcctggcgtgctgtcaaacgcaggcctattggcgtggccacggtatttgtattaaag
gcagagggttgcgatatgatattggtgtctgagaaggctgcgcgccgtcgggaatttctg
gctgacgttgttcacgctgcctttgatcctacagaggtcaatatttgtggagaaatgcag
ggaactcacgggcggagctggggtggaaataggtgcatggcacttatatcaatctggcaa
ttccaaaagctccagtacgagcacttcctactaaaggagctaacattcaagaccttcttg
gcgtatgacgagacggacttcaaagaagtggtagctgcctttggctcagggcgatttgcg
ggggtagaaaagatgattacccgccgtatctccttagatgagatcgtggagaaggggttc
aaagagctcacagagaatcccggggatcatataaagatcatagccagcccgaaaattcgg
ttactatga

DBGET integrated database retrieval system