KEGG   Paracoccidioides brasiliensis Pb18: PADG_02881Help
Entry
PADG_02881        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    PADG_02881
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbn03036]
    PADG_02881
Enzymes [BR:pbn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PADG_02881
Chromosome and associated proteins [BR:pbn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PADG_02881
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PADG_02881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET PALP
Motif
Other DBs
NCBI-GeneID: 22582290
NCBI-ProteinID: XP_010758176
UniProt: C1G6S6
LinkDB All DBs
Position
Unknown
AA seq 474 aa AA seqDB search
MVIDLTRDSSSEDDPRYGVEPEIRTPPLDEGLTLLQKFTRPSLRPGSSSSGGTTRNEWKS
TASTNGTVSSTLNGVLPSNKPPQPSFAVVVPSLGCDTGIKRRRLSSEDDSSSQANGVDPE
FPNHHGLSSFYSVERSSKALTYQPKQEVSRNRANIQIKQPAVRYHPFQKGHSDKDILSLY
LKKLQRIQGPPVTLKIDPSDASNIDFNFEFINEYKLQKGVKRVDPGFHVGCQCVGVCDSS
SCYHLDRLPNEDEDEDEDSEHQIIPYQVGRDGKVVLRHEFFRKRAMIYECSPLCTCLPSC
LNRVVQKGRTVKLEIFRTDNRGFGLRSPENIQAGQYIDRYLGEVITRKEADAREAATPKN
SASYLFQLDFFISAEENCYIVDGRKYGSITRFMNHSCRPNCRMFPVSQYEAERNIFDMAF
FAIKNIPAGTELTFDYCPYSDKEGSKAVDPDAVKCLCGERTCRGQLWPNQRKTM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggttattgaccttacaagagattcgtcctcagaagatgaccctcgctacggcgttgaa
ccagaaatccgcactccacctcttgatgaagggcttaccctacttcaaaaattcacacgt
ccgagcctacgaccagggagtagttcaagcggagggacaacgcgaaatgagtggaaaagt
acagcatctacaaacggcacagtttcgagtactttaaatggtgtgttgcctagcaacaag
ccaccccaaccctccttcgcggtcgtagtgccatcattggggtgtgatactggtattaaa
aggagacgcctgagctctgaagatgacagtagtagccaggctaatggagttgatcccgaa
tttccgaaccatcatgggctatcgtctttctactccgtggaaaggagcagcaaagctttg
acctaccaacctaagcaggaagttagtcggaatcgggccaacattcaaataaaacagcct
gctgtgcgctatcacccttttcagaaaggccactcagacaaggacatattgtcactctac
ttgaaaaagcttcagcggattcaagggccccctgtgacattaaagatagatccctccgac
gcctcaaacattgacttcaactttgagttcattaatgagtacaagcttcagaagggggtt
aaacgcgttgacccaggtttccatgtcggctgtcagtgtgtcggtgtctgtgattcatcc
agctgttatcacctggatcgcctccctaacgaggacgaggatgaagacgaagactcggaa
catcaaattataccttatcaagtggggcgggatggaaaagttgttctgaggcatgaattc
tttaggaaaagggcaatgatttatgaatgttcccctctctgtacttgccttccgagttgt
ttgaatcgggtcgtgcagaaaggccggacagttaaattggagattttccgaacagataac
cgtggctttggtctacgttccccagaaaacatccaagcaggacagtacattgataggtat
ctgggcgaagtgataacaaggaaagaagctgatgcccgagaagctgcaactcccaaaaac
tctgccagctacctatttcaactagacttcttcatttcagcagaggaaaattgctacata
gttgatggaagaaaatatggctccatcacgcgcttcatgaaccattcctgccgccctaat
tgcaggatgttccctgtctcccagtatgaagctgaacggaatatctttgacatggccttc
tttgctatcaagaatattccagcagggactgagctgacttttgactactgcccttattcc
gataaggagggttccaaggcagtcgatcctgatgcggttaagtgtttgtgcggggaacgg
acatgccgtggtcagttgtggccgaaccaacggaaaacaatgtag

DBGET integrated database retrieval system