KEGG   Paracoccidioides brasiliensis Pb18: PADG_03473Help
Entry
PADG_03473        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00052  Galactose metabolism
pbn00500  Starch and sucrose metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PADG_03473
   00500 Starch and sucrose metabolism
    PADG_03473
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PADG_03473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 22582772
NCBI-ProteinID: XP_010758417
UniProt: C1G5A3
LinkDB All DBs
Position
Unknown
AA seq 294 aa AA seqDB search
MRSPGNPLDAYKTYKRGNTFDVFVWNPYGSVHIRPAWPGYTVLPDFQLPVRKNGGQPELR
EFFDKVPLDGNLALHPVHPPFPLPGEPGNVSYYYPEDFDITNATETASASIAYLRQGASK
TSKNSSLTTTMSHEYLRTTPTPGFRNINHPPYVTNHVPGDLAVHAESPDATHSDGVVEYD
IHNLYRHHLLNVTYHGLRCFRAIVHVLSADRPSQGAGQGIGGSDSQSRRTSTFILCLKHC
RFRSTESRYSASMRAGSAATAMRNFCNRWMRLSAFFPFYINHNVLLAIPQEPYI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagccctggtaatccattagatgcgtacaaaacctacaagagaggaaatacgttt
gatgtgtttgtctggaatccatatggcagtgttcatatcagaccggcgtggccaggatac
actgtgttacctgattttcagctcccggttcgcaagaatggtggtcaacctgaattaaga
gaattctttgacaaagttccattggacggaaaccttgccctccatccagtgcatcccccg
ttcccgctaccgggagaacctggtaacgtcagctattattaccctgaggatttcgatatc
acaaacgcgacagaaactgcatctgcatcaatcgcatacctgcgtcaaggtgcatctaaa
acctccaaaaattcctctctgactacgacgatgagtcatgaataccttcgcaccactcca
accccaggatttcggaacatcaaccacccaccgtacgttaccaatcatgtcccgggcgat
ctggctgtgcacgcagaatcaccagacgcgacacattcggacggggttgtcgaatatgat
atccataacctctatagacatcatcttcttaacgtgacataccatggtctgaggtgtttt
cgagcaatcgtccacgtattatcggctgatcgaccttctcagggagcggggcagggcatt
gggggaagcgacagccagtcccgccggacctctacgtttattctatgcctcaagcattgt
cgttttcgctctacggaatcccgatattcggcgtcgatgcgtgcgggttcagcggcaaca
gcaatgaggaacttttgtaatcgatggatgcgactctctgctttctttcccttctacatt
aaccacaatgtgctcttagcaatcccacaagaaccatacatctag

DBGET integrated database retrieval system