KEGG   Paracoccidioides brasiliensis Pb18: PADG_04249Help
Entry
PADG_04249        CDS       T03549                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00020  Citrate cycle (TCA cycle)
pbn00480  Glutathione metabolism
pbn01100  Metabolic pathways
pbn01110  Biosynthesis of secondary metabolites
pbn01130  Biosynthesis of antibiotics
pbn01200  Carbon metabolism
pbn01210  2-Oxocarboxylic acid metabolism
pbn01230  Biosynthesis of amino acids
pbn04146  Peroxisome
Module
pbn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PADG_04249
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PADG_04249
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PADG_04249
Enzymes [BR:pbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PADG_04249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 22583413
NCBI-ProteinID: XP_010759382
UniProt: C1GAG3
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MLSVQLTSVHTRHSLSLLSLVPSPCARPVGRSLSAFSKKYSYSSSSSSYPSSSSSLRPSA
LLVHSSSVPVRNTPERTRWASIPTTQTRNMAASRRKIVVKNPVVELDGDEMTRIIWKDIK
DKGLEYRDKTNDQVTIDSAEAIKKYGVGVKCATITPDEERVKEFNLKQMWLSPNGTIRNI
LGGTVFREPIVINRVPRLVPGWKKPIIIGRHAFGDQYRAKDTVIPGPGTLELVYTPKGGQ
PERIKVFDFEGGGVAMSQYNTDDSISGFAHASFKLAILKGMPLYMSTKNTILKKYDGRFK
DIFQSIYESTYKKSFDAKGIWYEHRLIDDMVAQMIKSEGGFIIAMKNYDGDVQSDIVAQG
FGSLGLMTSTLTTPDGTAFESEAAHGTVTRHYREHQKGRETSTNPIASIFAWTRGLVRRG
QLDNTPDVVVWAEQLEQACIDVVDEEGIMTKDLALACGRKDRAAWVTTRVYLEAVERRLQ
KNLANAKL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgtgcagctaacatccgttcatacccgacactcactctcgctgctctctctt
gtcccgtccccttgtgctcgcccagtcggtcggtctttatccgctttctctaagaaatat
tcttattcttcctcatcctcttcctacccctcctcgtcttcctccttgcgcccttctgcc
ctcctcgtccacagctcctctgtccccgtccgaaatacccctgagagaactcgctgggca
tcaattcctaccacacaaactcgcaacatggctgcgtcccggcggaagattgtggtgaag
aaccccgtggtggaattggatggtgatgagatgacaaggattatttggaaagacatcaag
gataaaggcttggagtaccgtgataaaaccaatgatcaggttacgattgattccgcagag
gcgatcaagaagtatggggtaggcgttaaatgtgctactattactccagatgaggagaga
gttaaagaattcaacctcaagcagatgtggttgtctcccaacgggactatcagaaacatc
ctaggtggaaccgtcttccgtgaaccaattgtcatcaaccgcgtccccaggctggtacca
ggctggaaaaaacccattatcatcggtcgacatgcctttggcgaccaataccgtgccaaa
gatacagttattccaggtcccggtactctcgagctcgtctatacacccaagggtggccag
ccagagcgcatcaaggtctttgacttcgaaggcggcggagttgccatgagccaatacaac
accgacgactcgatctccggctttgcccatgccagcttcaaactggccatcttaaaagga
atgcccctctacatgagcaccaagaataccatcctcaagaaatacgacgggagatttaag
gatattttccagtctatctacgaatctacttataagaagagctttgatgccaagggtatc
tggtacgaacatagactcatcgatgatatggttgcgcagatgatcaagagcgaaggcggc
ttcatcattgccatgaagaactacgacggcgacgtccaatccgacatcgtagcccaaggc
tttggctccctcggcctcatgacctcaactctcacaactcccgacggcaccgccttcgaa
tccgaagccgcccacggcaccgttacccgccactaccgcgagcatcaaaagggccgcgaa
acctccaccaaccccatcgcatccatcttcgcctggactcgtggcctcgtccgccgcggg
cagctggacaacacaccggacgtggttgtgtgggctgagcagctggagcaggcgtgcatt
gatgttgtggatgaggaggggattatgactaaggaccttgcattagcgtgtgggaggaag
gatcgggcagcgtgggtgacgacgagagtgtatctggaggcggttgagaggaggttgcag
aagaatttagcgaacgcgaagttgtag

DBGET integrated database retrieval system