KEGG   Paracoccidioides brasiliensis Pb18: PADG_04432Help
Entry
PADG_04432        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00500  Starch and sucrose metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PADG_04432
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PADG_04432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966
Motif
Other DBs
NCBI-GeneID: 22583555
NCBI-ProteinID: XP_010759464
UniProt: C1GAZ6
LinkDB All DBs
Position
Unknown
AA seq 532 aa AA seqDB search
MLRLFILCYLAGLALAADTVDWKSRSIYQVLTDRFARTDGSTSAKCETSENLYCGGSWRG
IISKLDYIKGMGFSAIMISPVSKNVEGRVSYGEAYHGYWVQDLYQLNKHFGTHEDLLDLG
KEVHKRGMYLMVDIVINNMAFITNGRNPATAVDYSVLNPFNLQRYYHPYCKIKDWNNYDE
AQKCWIGDDIVALPDLNTESEEVTQMMEAWIKEFVANYSIDGIRIDAAKHVGTEYLKKVA
KASGVFATGEVFESDVNIACSYQNYIPSIPNYPVYFAMIKAFTAGNITALNDELSTVKTV
CRDTSALVTFSENHDLPRFPSYVQDLSLAKNVLTFTILSDGIPSYYQGQELHFSGSDTPA
NREALWLSQYNTEHTLYQLTSILNKFRSHVILTDSGYLTSSSYSIYRDGSSMAIHKGTNG
RHVIVVYSTQGENGGDYILNLGISYTPGLIVTEILSCKNYSIGWPGSLGVEMTKGLPMVF
YPAHLMAGSGLCGASNVSAPVKGKKTGESTSLRSGLTGWSVMLVAGFVVLLL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcctttttatactctgctacctcgccggactagcattagcagcggacaccgtc
gattggaaatccaggtcgatataccaggtcttaactgacagatttgcgaggactgatggt
tcgacttcggcgaaatgcgagacgagcgagaacctctactgcggaggatcatggaggggc
ataatcagcaagttggactatattaaaggaatgggcttcagtgccatcatgatctcaccg
gtctcgaaaaatgtcgaaggtcgcgttagttacggagaagcataccacggctactgggtt
caagatctataccaattgaacaaacattttggaactcacgaagatcttctcgaccttgga
aaagaggtgcataaacgggggatgtacttgatggtcgatatcgtcatcaataacatggcc
ttcataacgaatggcagaaaccctgccactgcggtcgattactctgtcctcaacccattt
aacctacaaaggtattaccacccgtactgtaagattaaggactggaataattacgatgag
gcgcaaaaatgttggataggggatgacatcgttgcacttccggatctcaacacggaatct
gaagaagtgactcagatgatggaggcctggatcaaagagtttgttgccaactactcgatt
gatggtattcgaattgatgccgcgaagcatgttggcacggaatacctgaagaaagtggcc
aaggcatctggcgtttttgcaacaggggaggtgtttgaaagcgacgtgaatatcgcctgc
agttaccaaaattatatccccagcattccgaactaccctgtttacttcgccatgattaaa
gcctttactgctggaaacatcactgcgttgaatgatgaactcagcacggtgaaaacggtt
tgccgtgataccagtgccctggtaaccttttcggagaaccatgatctccctcgattccca
tcttatgtccaagacctctctctcgccaagaacgtcctaaccttcacaatcctctccgat
ggcatccccagctattaccaaggacaagaactacacttctcaggatccgatacccccgcg
aaccgcgaagccctctggctctcacagtacaacactgaacacactctctaccaactaacc
tcaatcctcaacaagttccgctcccacgtcatcctcaccgactccggctacctcacatcc
agctcctactccatttacagagacgggagctccatggccattcacaaggggactaatggt
cgtcatgtgattgtcgtctactctactcagggtgagaatgggggtgactatatccttaat
ttgggcatttcatatacgcccgggctgatcgttacagaaattctgagctgtaagaattat
tcaattggttggcctgggtcccttggggttgagatgacgaaggggttgcccatggtgttc
tacccggcgcatctgatggctgggagcgggctgtgtggtgctagcaatgtgtctgctcct
gtcaaggggaagaagaccggggagtcgacgagtttaagatctgggctgacgggttggagc
gtgatgttggtggcggggtttgttgtgttattattatga

DBGET integrated database retrieval system