KEGG   Paracoccidioides brasiliensis: PADG_04800Help
Entry
PADG_04800        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
pbn  Paracoccidioides brasiliensis
Pathway
pbn03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    PADG_04800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pbn03400]
    PADG_04800
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     PADG_04800
DNA repair and recombination proteins [BR:pbn03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     PADG_04800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 22583844
NCBI-ProteinID: XP_010760384
UniProt: C1GCS8
LinkDB All DBs
Position
Unknown
AA seq 327 aa AA seqDB search
MPSVEGEGESDADDFVASPSFKGILNRFIYDSPPKKPLEALGSLKRKLSNDDDECITAVQ
EIRRITRSVSRASSTRPPPSPSPQRQKTQSQPALPSRRITPKSNRATSPVCNLRDTIPEN
LILLFIGVNPGIMTGQTGHVYAHPSNLYWKLLHSSGITTRRHPPSDTYRLPELYSVGNTN
IVARPTRDASQLSKKEMDEGVPVLERKIREKRPEAVCLVGKGIWEAVWRVKRGRAIRKEE
FKYGWQDEGERMGRSPGWKGARVFVATSTSGLAAGMSMAEKEAVWNQLGDWVKKRREERE
KEGVAKVAVPAAAAAGENGDGDGSVDG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccctccgtggaaggggaaggggaatccgatgcggatgacttcgtcgcctctccctct
ttcaagggcattctcaaccgtttcatctatgactctccacctaagaagcccctagaggcc
ctggggtctctcaagcgaaagctctccaatgacgatgacgagtgtataactgcagtccag
gaaataagacgcatcacccgctccgtctcccgcgcctcctccacgaggcctcctccgtcc
ccttccccgcagcggcagaagacccaatctcaacccgccctcccatcccgcagaatcacc
ccaaagtccaaccgtgccacatcccctgtatgcaacctccgcgacacgatccccgaaaac
ctcattctcctcttcataggtgtgaacccgggtatcatgaccgggcaaacgggccacgtc
tacgcacacccttccaacctatactggaagctcttacattcctccggcataacgacgcgt
cgtcaccccccctcagacacctaccgtctacctgaattatacagcgtcgggaacacgaat
atcgtcgcgagaccgacgcgggatgcaagccaattatcgaagaaagagatggacgagggt
gttcccgtgctagaacggaagattcgagagaagaggcctgaggctgtatgtctcgtcggc
aaggggatttgggaggcggtgtggagggtgaaaaggggaagggcgattaggaaggaggaa
tttaagtatgggtggcaggacgagggggagaggatgggaaggtcgccgggttggaagggg
gctagggtgtttgtggcgacttcgactagtgggttggccgctgggatgagtatggcggag
aaagaggctgtttggaatcaattgggggattgggttaagaagaggagggaggaaagggaa
aaggagggagtggccaaggttgcggttcctgcggctgcggctgcgggtgaaaatggggat
ggggatggcagtgtggatgggtga

DBGET integrated database retrieval system