KEGG   Paracoccidioides brasiliensis Pb18: PADG_05364Help
Entry
PADG_05364        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn03030  DNA replication
pbn03410  Base excision repair
pbn03420  Nucleotide excision repair
pbn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pbn00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PADG_05364
   03410 Base excision repair
    PADG_05364
   03420 Nucleotide excision repair
    PADG_05364
   03430 Mismatch repair
    PADG_05364
Enzymes [BR:pbn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PADG_05364
    6.5.1.6  DNA ligase (ATP or NAD+)
     PADG_05364
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PADG_05364
DNA replication proteins [BR:pbn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PADG_05364
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PADG_05364
DNA repair and recombination proteins [BR:pbn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PADG_05364
   NER (nucleotide excision repair)
    Other NER factors
     PADG_05364
   MMR (mismatch exicision repair)
    Other MMR factors
     PADG_05364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 22584308
NCBI-ProteinID: XP_010760709
UniProt: C1GDM8
LinkDB All DBs
Position
Unknown
AA seq 1035 aa AA seqDB search
MRHLPLPSPFAKINIPPFLTSPHNLLPQFGTHSTALHPGDQTPSYRGCLVPNLPYRRLER
RERHRPFSTAVCAAGSCQCPRQTRGAVLVVIPCRAYTASNGSLSLVGEVDDMMQRGGGGG
GGGGGGGGGKQATLGYVRDPQLSIGKFFGANAGSASVLKKQSTLAFSSGTRDKKKQEKTA
TETNDEKLSNGEKDVEMSDVEAGGESKGDSPPPAAGKEESDANSGSEKVPDSRSENSSPG
SKKLKRDKTHVEEESEESDIQPATKRRKRSTPEKKRASPKPKTADKKPVASKAKGRSKSP
QSPKKVKEPVDETKESTSAEKDDVDSVNDDEIGEETPEVAQKDRETVQQVLKSSGKDPYP
DWKVGDPVPYAALCTTFSLIEMTTKRLVILSHCSLFLRQVLRLTPNDLLPTVQLMLNKLA
ADYAGIELGIGESLIMKAIGESTGRSLAVIKADQHEIGDLGLVAAKSRSNQPTMFKPKPL
TVRGVHDGLLAIAKTQGHGSQDKKISAIKKLLSSADAAVAGKGSKGIDITHNKGGPSEAK
FIIRFLEGKLRLGLAERTVLVALAHAMVAHEVELQGKKAPTTEQLAKGEEILKSVYSELP
SYEVIIPAMLEHGIFNLKDKCKLQPGVPLKPMLAKPTKSITEVLDRFEGKNFTCEYKYDG
ERAQIHYISREAISEYRATASTLQKDGGGVCAIFSRNSEDLSKKYPDILSKLENWVKKGT
TSFVLDCETVAWDVAGKKVLPFQQLMTRKRKDVKAEDVKVKVCVFAFDLLFLNGEPTVKK
TLRERRSLLHEAFVPVEGEFVFAQHGDTSDLEEIQTLLDESVKASCEGLMVKMLDTEESG
YEPSKRSRNWLKVVKKDYLAGIGDSLDLVVLGAYYGRGKRTSVYGAFLLAAYNPTTQNYE
TICNIGTGFSEALLEELHSALSPLVIDRPKPFYDHSSVPKDQPDVWFEPKYVWEVKAADL
TLSPRYKAAADEILGSENGTAKGISLRFPRYIKSREDKKPDEATTTRTVADMYRKQESVA
NVAAAKGGVDDDFEY
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatcttcccctcccttctcccttcgccaaaatcaacattcctccattcctcacc
tcaccgcataacctccttccccagtttggaacgcacagcaccgctctccaccccggggac
caaacgcctagctatcgcgggtgcctagtccccaacttgccatatagaagactagaaaga
cgagaaagacatagacctttttcgacagctgtgtgtgctgctggtagctgtcagtgtcca
cggcagactcgaggggctgttttggttgtgataccctgcagggcttatacggcttctaac
ggttctttgtcgttggttggagaagtggacgatatgatgcagagaggaggaggaggaggt
ggtggtggtggtggcggtggcggtgggaaacaggctactttggggtacgttagagatccg
cagttgagtatcgggaagttctttggtgccaatgctggttccgcatctgttctgaaaaaa
caatctaccctggcattttcatctgggacaagggacaaaaagaaacaggagaaaaccgcc
acagaaacgaatgatgaaaagttaagtaatggggagaaagatgttgaaatgagtgatgtt
gaggctggtggagaatcgaagggcgacagccctcctcctgctgcgggaaaggaggaatcg
gatgcaaatagcggatctgagaaggtaccggatagcaggagcgagaacagctctcctgga
tccaagaaactaaaacgagacaaaacccacgtggaagaggagagtgaagagtctgacatt
cagccggctaccaagagacgaaagcggtctacaccagagaagaaacgcgcatctccaaag
cccaagactgctgacaaaaagcctgttgcttccaaagctaaaggtcgaagtaaatcacca
caatccccgaagaaagtgaaggagcccgttgatgaaaccaaggaatccacatccgccgaa
aaggacgatgtagattctgtaaatgatgatgaaataggagaagagacgccagaagttgct
cagaaggatagagaaacagtgcagcaggtactgaaatcaagtgggaaggatccctatcca
gactggaaagttggagacccagttccatatgccgcgctctgcaccactttttccctcatc
gaaatgacgacaaaacggctggttatattatcccactgctctcttttccttcgtcaggtg
ctccgccttaccccaaacgacctcctcccaaccgtccagctaatgctaaacaaactcgct
gctgattatgccggcatcgaactcggaattggcgaatcgctcatcatgaaggccattgga
gaatctacaggccgcagcctggcagtgatcaaagcagaccagcatgaaatcggcgatctt
ggacttgtagctgccaagagccgctcaaaccagccaaccatgttcaaacccaaaccattg
actgtccgaggggttcatgatggtcttcttgcaattgctaagacacagggccatggatct
caagacaagaagatttcagctattaaaaagctgctatcgtctgccgatgctgctgtggca
ggaaagggatcgaaaggcattgacatcacgcacaacaagggcgggccaagtgaggccaaa
tttatcattcgtttccttgaaggtaaactacgtctgggtcttgctgaaaggacggtactc
gtggcactcgctcatgcgatggtggcccacgaggttgaactgcaagggaaaaaagcacct
actactgaacaactggcgaagggtgaagagattcttaaatctgtgtatagtgaacttcct
tcatatgaagttattattccggctatgcttgagcatggaatcttcaacttgaaggataaa
tgcaaattgcaacctggagtgccgctgaaacctatgttggctaaaccaacaaagtccatc
actgaggttctcgatcgcttcgaaggtaaaaactttacgtgtgagtacaagtatgatggt
gaaagagcgcaaatacattatattagtcgggaggcaatctctgaatatcgtgcgacggcc
tcaaccctacagaaagacggagggggcgtatgtgccattttctctcgcaattctgaagac
ttgtcaaagaagtacccggatatccttagcaaactagagaactgggttaagaagggcact
acaagtttcgtgctggactgcgaaacagtggcgtgggatgttgcgggcaagaaggttctg
ccatttcagcagcttatgacgaggaagcggaaggatgtcaaggcggaagatgtcaaggtt
aaagtctgtgtgtttgcgtttgatttgctatttctgaatggagaacccaccgtgaagaaa
acccttcgagaacgaagaagtctactgcatgaggcgtttgtgcccgttgaaggcgagttc
gtcttcgcccagcacggtgataccagtgatctcgaggaaattcagacgttgctcgacgag
agtgttaaagcatcctgtgagggcctgatggtgaagatgcttgatacggaagaaagcgga
tacgaacccagtaaacggagccggaattggctcaaggtagttaaaaaagactacctagcc
ggaatcggcgactctctcgacctagtcgtactgggcgcctattacggacgcggcaaacgc
acatccgtctacggcgctttcctcctcgccgcctacaatcccaccacccaaaactacgaa
acaatctgcaacatcggcaccggcttctccgaagcgctcctcgaagaactacacagcgct
ctctccccactcgtcatcgaccgtcctaaacctttctacgaccactcctccgtccccaag
gaccagccggacgtctggttcgagcccaaatatgtctgggaagtcaaagcggcagacctg
acgcttagtccgcgctataaggctgccgccgatgagattttgggcagcgagaatgggacc
gctaagggcatttcgctccggtttcccaggtatataaagagtcgggaggataagaagcct
gatgaggcgacgacgacgaggactgtggcggatatgtataggaagcaagaaagtgtggcg
aacgttgcggctgcgaaggggggggtggatgatgattttgagtattga

DBGET integrated database retrieval system