KEGG   Paracoccidioides brasiliensis Pb18: PADG_05778Help
Entry
PADG_05778        CDS       T03549                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00500  Starch and sucrose metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PADG_05778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbn01003]
    PADG_05778
Enzymes [BR:pbn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PADG_05778
Glycosyltransferases [BR:pbn01003]
 Polysaccharide
  Storage polysaccharide
   PADG_05778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 22584647
NCBI-ProteinID: XP_010761413
UniProt: C1GEU2
LinkDB All DBs
Position
Unknown
AA seq 708 aa AA seqDB search
MSSPHTPKRDIKNHVLFEIATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLNRSSV
EVEVEELTPTDPHIAATIASMKERGVDMIYGRWLIEGAPRVVLIDTGAGYKYLDEWKGDL
WNAAGIPSPAEDSESNEAIVFGYLVAWFLGEYISRDRTRAVVAHFHEWLAGIALPLTKKR
HMDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAAAHSADV
FTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFAAVHEFQNLHSHAKDKINDFVRGHFYG
HNDFDLDNTLYFFIAGRYEYRNKGVDMFIESLARLNHQLKTSGLTTTVVAFIIMPAQTSS
LTVEALKGQAVVKSLRDTLEMVEQGIGKRLFERCLSWKEGDNMPDEKDLITNQDRVLLRR
RLFAMKRHQLPPIVTHNMINDAEDPVLNQLRRVQLFNHPSDRVKVVFHPEFLNSSNPVLP
LDYDDFVRGTNLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRMKGVDESVNQLTNFMFEFACKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPSSFDPAEDFSDIIGGTEQKISRPFSVPGSPRDRTGMMTPGDFGSLQEGREGL
STEDYIAWKLPEEEDADEYPFPLTLRKKATTVIPPHSPEREVTANGDV
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcccgcatactccaaaacgagatatcaagaaccacgttctatttgaaattgca
accgaagttgcaaaccgggttggtggaatatactctgtcctgaagtccaaggcgccggtt
acgacagcagagtatggcgaaagatacacactcatcggccctctgaatcgctcatcggtc
gaggtcgaagtcgaggaacttaccccaaccgatcctcatattgccgccacaattgcctct
atgaaagaacggggagttgatatgatctatgggcggtggcttatcgagggagcgccgaga
gtagtcctaattgacacgggtgcgggatacaaatacctggacgagtggaagggtgatctt
tggaatgcggccggaatcccgtctcctgcggaggatagtgagtcgaatgaagctatcgtt
tttggctatttagtagcttggttccttggtgagtatatctccagagatagaactcgagct
gttgtcgcgcatttccacgagtggctagccggtattgcccttcccttaaccaagaagcgg
catatggacgtcacaaccattttcacgacccatgcaacactcctaggtagatatctgtgc
gccggatctgtcgatttttataacaacctacaatacttcgacgttgacgctgaagccggg
aaaagagggatctaccatcgatactgcattgaacgcgctgctgcgcattcggcagatgtg
ttcacaacggtgtcacacatcacagcgttcgagagcgagcatcttctgaaacggaagccc
gatggtgttttgcccaacggacttaacgtgaagaagtttgctgcagttcacgagttccaa
aatcttcattcccatgccaaagacaagatcaatgactttgtccgtggtcatttctatgga
cacaacgactttgatctcgataatactctatacttcttcattgcaggtcgttatgagtat
cggaacaagggggtggatatgtttatcgaatctctcgcgagactgaatcatcaactcaaa
acatctggcttaactactactgtagtcgcattcattatcatgcccgcacagacatcgtcg
ctcacagttgaggccctcaaaggccaagccgttgtgaaatctcttcgcgacacactagaa
atggttgagcagggaattgggaagcggctattcgagcgttgtttgagttggaaggaagga
gacaatatgcccgatgaaaaggatttaatcacaaaccaggaccgtgtactcctgcgccgt
cgactcttcgcaatgaagcggcatcagcttccacccatcgtgacacataacatgataaat
gacgcagaagacccagtgctgaaccagctgcgccgtgtccaactcttcaaccacccgtcc
gatcgtgtcaaggtggttttccacccggaatttctcaattcgtcaaacccagttttgccc
ctcgattacgacgattttgtccgcgggacaaatctaggcgttttcccatcctactatgag
ccgtgggggtacacccctgcggagtgcacggttatggggatacccagcataaccactaac
ctctccggattcggatgctacatggaggaactcatagaaaactcgtcggattacggaata
tacattgtcgaccggcgcatgaagggtgtggatgaatccgtgaaccagctgacgaacttt
atgtttgaatttgcgtgcaaaagccgacggcaacgtatcaatcagcgcaatcggacggag
cggctaagtgatttgctcgactggaagaggatgggcatggagtatgtcaaagcgcggcag
ctggcgctccgaagagcgtatccgtcctcctttgaccccgcggaggacttcagcgatatc
attggaggaaccgagcagaagatatcccgcccgttctctgtacccggttctcctcgcgat
cgaacgggaatgatgacccctggtgactttgggtcgttgcaggagggtcgcgagggtctg
agtacggaagattatattgcctggaagctacctgaggaggaagatgcggacgaatatccg
ttcccacttacgttgcgaaagaaagctactacggttatccctccgcactccccagagaga
gaggtaacggccaacggtgacgtgtag

DBGET integrated database retrieval system