KEGG   Paracoccidioides brasiliensis Pb18: PADG_06319Help
Entry
PADG_06319        CDS       T03549                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00250  Alanine, aspartate and glutamate metabolism
pbn00410  beta-Alanine metabolism
pbn00430  Taurine and hypotaurine metabolism
pbn00650  Butanoate metabolism
pbn01100  Metabolic pathways
pbn01110  Biosynthesis of secondary metabolites
Module
pbn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PADG_06319
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PADG_06319
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PADG_06319
   00430 Taurine and hypotaurine metabolism
    PADG_06319
Enzymes [BR:pbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PADG_06319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 22585072
NCBI-ProteinID: XP_010761850
UniProt: C1GG82
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MVHLAAIRRESVALPNRPIQRIETIPLEEPQEHDFFSSVYGSRFAAEDLPTLEMPEKEMP
KEVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMTESLSKNFIDYEEYPQSAEIQN
RCVNMIARMFNAPGEDSEEHAMGTSCVGSSEAIMLGTLAMKRRWQNKRRAEGKDCSNPNI
IMSSAVQVCWEKAARYFEIEEKFVYCTSDRYVIDPEEAVNLVDENTIGICAILGTTYTGQ
YEDVQRINDLLVERGIDCPIHVDAASGGFVAPFVNPNLEWDFRLEKVVSINVSGHKYGLV
YPGVGWIVWRSPEYLPKELVFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYR
NIMINLTRTADYLSSVLKELGFIIMSDGRGHGLPLVAFHLSSDQGYEFDEFALAHQLRER
GWVVPAYTMAPHSEQLKLMRIVVREDFSRSRCDSLLADIKLALEQLSEMDRKVMEKYQHH
IRQHVSNVGKATHNHPHYQDEDHSLQGKTGKTHAIC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctcgcagcaatccgaagggaatcagttgcgcttccgaatagaccaattcag
cgtatcgaaaccatcccccttgaggagcctcaggaacatgacttcttctccagcgtctat
ggctctcggttcgcggcagaggacctgcctacactcgagatgccggagaaagaaatgccc
aaggaggtggcatatagaatgatcaaggacgagttgagtctggatgggaatcctatgttg
aacttggcgagtttcgttaccacatacatggaggaggaagctgaaaaactcatgactgag
tcgttgagcaagaacttcattgactacgaggaatacccacagtctgcagagattcagaac
cgctgcgtcaacatgattgctcgcatgttcaatgctcctggagaagattcggaagaacat
gccatggggacctcgtgcgtaggttcttccgaagccatcatgctgggcacgctcgctatg
aaaaggcgctggcaaaataaaagaagggcagaaggaaaagattgctccaatcccaacatt
attatgagcagcgctgttcaggtatgttgggaaaaggcagcgagatattttgaaattgag
gagaaattcgtctactgcaccagtgatagatacgtcattgatccagaagaggctgtcaat
ctcgtggatgagaataccattggcatttgtgcaattttaggcaccacatacactggccag
tatgaagatgtacagaggattaacgatcttcttgtcgaacgtggaatcgattgtcccatc
catgttgacgcagcaagcggtggatttgtggcaccctttgtaaacccgaatttggaatgg
gatttcagacttgagaaggttgtttctataaatgtctctggacacaaatatggtctcgta
tacccgggtgttggctggattgtttggcgttctccggaatatctccccaaggagctcgtt
ttcaacattaactatcttggggccgaacaagccagctttaccctaaacttctccaagggc
gcgtcgcaagttatcggccagtattatcaaatgatccgccttgggaaacgcggctaccgc
aatataatgatcaatctcacgcgcaccgcggactatctctcctcagtgctgaaagaatta
ggtttcatcatcatgagcgacgggaggggccatggtctgcctcttgtagccttccatcta
tcttctgaccagggctatgagtttgatgagtttgcgctggctcaccagttgcgggaacgc
ggctgggttgttcctgcatataccatggcgccgcatagtgagcagttgaaactcatgcgt
attgtggttcgagaagactttagcagaagtcgttgcgattcgttgctggctgatatcaaa
cttgcattggagcagctgagtgagatggaccgaaaagttatggagaaatatcaacaccat
atccgccaacacgtttccaacgtcggcaaggcaactcataatcacccccattaccaggat
gaagaccactccctacaaggaaagacagggaaaactcacgctatctgctaa

DBGET integrated database retrieval system