KEGG   Paracoccidioides brasiliensis Pb18: PADG_07085Help
Entry
PADG_07085        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
pbn  Paracoccidioides brasiliensis Pb18
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pbn03021]
    PADG_07085
   03036 Chromosome and associated proteins [BR:pbn03036]
    PADG_07085
Transcription machinery [BR:pbn03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     PADG_07085
Chromosome and associated proteins [BR:pbn03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    PADG_07085
   PBAF complex
    PADG_07085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 22585658
NCBI-ProteinID: XP_010762541
UniProt: C1GIJ9
LinkDB All DBs
Position
Unknown
AA seq 730 aa AA seqDB search
MEDLNAASSEMITDDQAVAPLQDGQPGTEMPTTTHSSSQGSGSQSQPLSPSKANQEAAIS
DNPLDAPASPKPQNEEQEPEDEKMGGTDTESKREDGVVGDEAGEGSTPQQQSAENVDGQL
TQTKASLEASARSHLVAQTHAIILPSYTIWFDMNTIHAIEKKSLPEFFNSRNRSKTPAIY
KDYRDFMINTYRLNPVEYLTVTACRRNLAGDVCAIMRVHSFLEHWGLINYQVDPQTRPSN
LGPPMTGHFRITADTPRGLQPFQPAPNTIVTPGKPHPSTERAASATPIPKSDLNLEIRRN
IYDEKGKGITSAEDKENQTNGEAQSTNGAGGDSSIKTMEAAAKETKKICHCHSCGIDCTR
LRFHYAKCVPVTTNSNAPDSKYDLCPNCFLQGRLPSSHNASDFVKLEDSPYTTIPDRDAP
WSNSELLLLLEALENFDDNWRQIARHVGTRTPEECVMKFLQMEIEDKYLEDTQDISLMSS
RSGREPISQLDNPVLSVVSYLAEMTEPAVAAAAAGRSVEEIRRKLQKQLEQGFKGATSAD
NQEKDKDTDKGKEEKTMESEDTMEVDITNEGDSTSVVRSTVGDKQSSRPSIASIGLGTAA
ARAAAFASNEEREMTRLVATAVNITLQKFEIKLAQFSELEKIVEAERRDLEQGRQQLFLD
RMALKKRIKEVQELLKNASLAGLEEGAAMVLDAETVGITERYEFQQPPAEQARSVRPPST
QEDDFKTFSL
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggaggatctaaatgcagcctcaagcgagatgattactgatgaccaggcggtcgctcct
ctccaggatgggcagccgggaactgagatgcccaccaccacccattcttccagtcaaggc
tcaggctcgcagtctcaacccctttcgccttctaaagcaaatcaggaggctgcgatttca
gataatcccttagatgcgcctgcgtcaccaaagcctcaaaacgaagagcaagaaccagaa
gacgagaaaatggggggaacggatacagaatcgaaaagagaagacggtgtagtgggcgac
gaagctggcgagggctccacaccccagcagcaatcagctgaaaatgttgatggccagttg
acacagaccaaagcttctctggaggcatcggcacgttcacacctggtagctcaaacacat
gctatcattcttccaagctacacgatttggttcgatatgaacacgattcatgctattgag
aagaagtctcttccggagtttttcaatagtcgaaaccgtagcaaaactcctgccatctac
aaggactatcgcgactttatgatcaacacttatcgcctgaaccctgtcgagtaccttacg
gttactgcgtgtcgacgaaacttagctggtgatgtgtgcgcgattatgcgtgtacactca
ttcctggagcactggggcttaatcaactaccaggtcgaccctcagacacgtccatcaaac
cttggacccccaatgactggccattttagaattacggcagacactccccgtggcctgcag
ccgttccagcccgcacccaacacaattgtcactcctggtaaaccccacccatccactgaa
agggccgcgtcggctactccgatccctaagagtgatcttaacctcgagatccgccgcaac
atctatgatgagaagggtaaaggcattacatccgctgaggacaaagaaaaccagacgaac
ggcgaagctcaaagtacaaacggagccggcggagattcttccatcaaaaccatggaagct
gccgcaaaggaaacgaaaaagatttgccactgccattcctgtggtattgactgcacaagg
ttaagattccattatgcgaaatgtgttccagtgacgactaattctaatgctccggattcg
aaatacgatttgtgcccgaactgcttcctacaaggcagattgccgtcctctcacaatgcc
tcagactttgtcaaattggaggatagtccgtatactactattccagatcgggatgctcca
tggagcaactctgagctgctactccttctcgaggcattggagaacttcgacgacaactgg
cgacaaattgctcgacatgtcggaacacgtacccctgaagaatgcgtcatgaaattcctc
caaatggaaatcgaagataaatatctggaggacacgcaggatatctccctgatgagttct
aggagcggaagagagcctattagccaacttgacaatcctgtgctctccgttgtatcttac
ttggcagagatgactgagccagcagttgcggcagcggcggcaggtcgatccgtggaagaa
atacgccgcaaactccagaagcaactcgagcaaggctttaaaggtgctacatctgcagat
aaccaagaaaaagataaggacacagacaagggtaaagaggaaaagactatggaatccgag
gacacaatggaagtcgatatcacgaacgaaggtgattcgacgtcagtcgtccggagcaca
gtaggcgacaaacaatcctcgcgcccttccatcgcatctatcggcctgggcactgctgct
gctcgagcagcagctttcgcttcaaatgaggagagggagatgacgcgtttggtagctacg
gccgttaacataactctgcaaaagttcgaaatcaagctggcacagttttctgagctggag
aagattgttgaggctgagcgcagagatttggagcaaggtcgtcagcaactcttccttgat
cgtatggcgcttaaaaaaaggattaaggaagttcaagagctccttaagaatgcctccttg
gcggggctggaggagggagctgcaatggtgctcgatgcggaaacagttggtataacagaa
cgatatgaattccagcaaccacctgctgaacaagcgagaagcgttcggcctccaagcacg
caggaggatgatttcaaaacattttctctatga

DBGET integrated database retrieval system