KEGG   Paracoccidioides brasiliensis Pb18: PADG_07418Help
Entry
PADG_07418        CDS       T03549                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pbn00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PADG_07418
Enzymes [BR:pbn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PADG_07418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 22585913
NCBI-ProteinID: XP_010762727
UniProt: C1GJI2
LinkDB All DBs
Position
Unknown
AA seq 166 aa AA seqDB search
MVKAVAVLRGDSNVKGTVVFEQASESSATVITYSLSGNDPNALRGFHIHQFGDNTNGCTS
AGPHFNPFGKSHGSPTDTERHVGDLGNITTDAQGNASGMMEDIFIKLIGEHSVLGRTVVV
HAGTDDLGKGGNEESKKTGNAGPRPACGMYLISQFFANGYGYGILN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggccgtcgctgttctccgtggtgactccaatgtcaagggcactgtagtcttc
gagcaggcttcggagtcttccgcaaccgtcatcacatacagcctttctggcaacgaccca
aatgcccttcgcggctttcacatccatcagtttggcgacaataccaatggctgcacatct
gccggccctcacttcaacccgttcggcaaatcccacggttctcccaccgatactgagcgc
catgttggagacctaggaaacattaccactgacgctcagggaaacgcttctggcatgatg
gaggatatcttcatcaagctcattggcgaacacagtgtgcttggacgcactgtcgtcgtc
cacgctggcactgatgaccttggaaagggtggaaacgaagaatccaagaagaccggcaac
gctggtccccgccccgcctgtggtatgtatcttatctcccagttctttgcgaatggatat
gggtatgggatcttgaactaa

DBGET integrated database retrieval system