KEGG   Paracoccidioides brasiliensis Pb18: PADG_07475Help
Entry
PADG_07475        CDS       T03549                                 

Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00020  Citrate cycle (TCA cycle)
pbn00190  Oxidative phosphorylation
pbn01100  Metabolic pathways
pbn01110  Biosynthesis of secondary metabolites
pbn01130  Biosynthesis of antibiotics
pbn01200  Carbon metabolism
Module
pbn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbn_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PADG_07475
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PADG_07475
Enzymes [BR:pbn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PADG_07475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 22585958
NCBI-ProteinID: XP_010762753
UniProt: C1GJN9
LinkDB All DBs
Position
Unknown
AA seq 659 aa AA seqDB search
MPMRRILAPTRRHFPLADKVDMHLSSTSYFPKYNGYIRKPSAGLDNQRLWKRSFSSTSGL
YALQGVGQAKAVGLNHTQIIDHRYDALVVGAGGAGLMAAVGLAESGLETASAQGGINAAL
GNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCKEASKTVLELEGYGMPFSRTAEGKIYQR
PIGGQSLKYGSGGQAYRTACAADRTGHAMLHALYGQSLKHDCKFFIEFFALDLMMVDGRC
VGVTALDMETGTLHRLFSRNTIIATGGYGRAYFSCTSAHTSTGDGCAMASRAGLPLQDME
FVQFHPSGIYSAGVLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVARSMNMEI
REGRGVGPHKDHIYLQLSHLPKELILERLPGIAETASIFAGIDITRQPIPVLPTVHYCMG
GIPTNYKGQVLNVDLATGKETPVPGLYAAGEAACVSVHGANRLGANSLLDIAVFGRASAT
HIAENNENGMPHSSVPRDIGMPSFQDMERLRTSDGSKLTAELRLDMQKAMQSDVAVFRTE
DSLTAGVSKVQQVEHSFKHDVCVKDKSLIWNSDLIETLEMRNLLTCAAQTAKSALDRKES
RGSHAREDFPDRDDVRLLKHSLSWQTEETEPVKVGYRDVIFATLDETDCPSVAPKKRTY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgaggaggatcctcgcgccaacccgccggcacttccccttggccgacaaagtc
gacatgcacctatcctctacctcctatttcccgaaatataatggctacataaggaagccg
tcggcaggccttgacaaccagcggttatggaagaggagtttcagctccacgtcaggacta
tatgcgctacaaggggttgggcaggcaaaggctgttgggcttaatcatacccagataatt
gatcaccgatatgacgcccttgttgttggtgcaggaggagcaggtcttatggcggccgtt
ggcttggcggaaagtggactggaaaccgcctctgctcaaggcggtatcaatgctgccctt
ggcaatatgacagaggacgactggagatggcatatgtatgatacggttaaaggctcagac
tggctaggggatcaggatgcaattcattacatgtgcaaggaagcctcgaaaaccgtttta
gagttggaaggatatgggatgccattttcccggactgcagagggcaagatttatcagcgt
cctattggaggacaatccttgaaatacggttctggcggccaagcctatcgaactgcgtgt
gcagctgatcgtaccggacatgcgatgctgcatgccttgtatggccaatctttaaagcat
gattgcaaatttttcattgagttcttcgccttagacctgatgatggtcgatggccggtgc
gtcggtgtaactgcacttgacatggaaaccggcacgcttcaccgtctgttcagcaggaac
acaatcatagcgactggtggatacggccgcgcctatttctcctgcacgtccgcacatact
agcacgggtgacgggtgcgccatggcatctagagctggccttcctcttcaagacatggaa
tttgttcagtttcaccctagcggaatatacagcgcaggtgtgctgattaccgaaggtgca
cgtggagaaggaggctacctacttaactctgaaggagagagattcatggaacgatacgcg
ccaaccgccaaggaccttgctagccgagacgtggtggcccgatccatgaacatggagatc
agagagggaaggggtgttggtccacacaaggatcatatttacttgcaactatcccatctt
cccaaggaactgatcctagaacggcttcctggaattgcagaaacggcctctatcttcgcg
ggcattgacattacccggcaaccgattcccgtacttcccaccgtccattattgtatgggc
ggtatcccaaccaactacaagggccaagtcctaaacgttgatcttgcaaccggaaaagag
acacctgtccccggactttatgcagctggagaggctgcatgtgtgagcgtacatggcgca
aatagactaggagccaactccctgctcgacattgccgtgtttggtcgtgcaagtgccact
catattgcagaaaacaacgaaaatggaatgccgcacagctccgttccaagggatatcggt
atgccatcattccaagacatggaacgactccgcacatcagacggaagcaaattaactgcc
gagctgcgcttggacatgcaaaaggccatgcagtctgacgtcgcggtgtttcgaacagaa
gactcgctcacggctggtgtctctaaagtacagcaggttgagcactcattcaaacatgat
gtttgcgtaaaggacaaatcactaatctggaattctgatttgattgagaccttggagatg
aggaatcttctcacgtgtgctgctcagacggctaaaagcgctttggacaggaaagagagc
agaggtagccatgctcgtgaagacttccctgatcgagatgatgtgcggttattaaaacac
agcctctcgtggcagacggaggagacggagccggttaaggtgggttatcgggatgttatt
tttgcgacgttggatgagacagattgcccaagcgtggcaccaaagaaaaggacatattaa

DBGET integrated database retrieval system