KEGG   Paracoccidioides brasiliensis Pb18: PADG_11178Help
Entry
PADG_11178        CDS       T03549                                 

Gene name
PADG_00973
Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn03030  DNA replication
pbn03410  Base excision repair
pbn03420  Nucleotide excision repair
pbn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PADG_11178 (PADG_00973)
   03410 Base excision repair
    PADG_11178 (PADG_00973)
   03420 Nucleotide excision repair
    PADG_11178 (PADG_00973)
   03430 Mismatch repair
    PADG_11178 (PADG_00973)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pbn03032]
    PADG_11178 (PADG_00973)
   03400 DNA repair and recombination proteins [BR:pbn03400]
    PADG_11178 (PADG_00973)
Enzymes [BR:pbn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PADG_11178 (PADG_00973)
    6.5.1.6  DNA ligase (ATP or NAD+)
     PADG_11178 (PADG_00973)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PADG_11178 (PADG_00973)
DNA replication proteins [BR:pbn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PADG_11178 (PADG_00973)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PADG_11178 (PADG_00973)
DNA repair and recombination proteins [BR:pbn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PADG_11178 (PADG_00973)
   NER (nucleotide excision repair)
    Other NER factors
     PADG_11178 (PADG_00973)
   MMR (mismatch excision repair)
    Other MMR factors
     PADG_11178 (PADG_00973)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 22587075
NCBI-ProteinID: XP_010756773
UniProt: A0A0A0HZI0
LinkDB All DBs
Position
Unknown
AA seq 850 aa AA seqDB search
MPIPAKKRKLNEPGPANQRTRGIESFFRSQKSASAAITPAQLEPGTPLADEELARKLQAK
WDEEAKSGNQCSSNLQDYQNPSTLEAKPEGLTQEFGTRLQTHGTPACGDVSGNGKPNRVL
SLQISSSAEDTISQSIPFDQSPLTFEPSSYAENLRAHWALEGGHASYAILTRAFVLVNNT
QSRIKIVDTLVNLLRLLIEADPGSLVFAVWLATNAIAPPYVPVELGLGGSAISKALKTAY
GLNNQGLKALWDKFGDAGDVAFEAKKRQTFTLRKPKPLSIRGVYESLLKISRSKGPGSQE
IKQRIVEKLLQDARGAEESRYIVRTLVQHLRIGAVKTTMLIALARAFLYSRPSTKDFFVY
NRIELSKLKKEEMASIYSRAEEIVKASYARHPSYDDLVSCLLEIGISDELLVRCGLTLHV
PLHPMLGSITRDLPQMLTKLQGRAFTCEYKYDGQRAQVHYDSSGKVSIFSRHLELMTDKY
PDLVALIPRIRGEGVSSFILEGEIVAVNQETGELLAFQTLTNRAKKNVGIESIKISICLF
AFDLMLLNGEPLLERPLRERRELLRGLFIEVPHHFTWVKNLDATSSDSEAVLSFFKEATD
AKCEGLMVKLLGGSVQPELSKEESVAEPNLNSDLILTTGHVEPNGNNKTRARRSLLSTYE
PDKRLESWLKVKKDYSAASDTLDLIPIAAWHGQGRKAKWWSPILLAVRNLETGMLEAVTK
CISGFTDKFYQANKEKYAEGSDNIISRPSYVDYRSQPEVWFEPQEVWEVAFADITLSPTY
TAAIGLVSDERGLSLRFPRFVRVREDKGLEEASSSDYLANLWRKQTERLREEGAIANPIA
ETDHFGSEDD
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcctgctaaaaagcgcaagttaaatgagcctggaccggcgaaccaacggact
cggggaatcgaatcattcttccggagccaaaaatctgcttcggcagcaatcactcctgct
caactagaacctgggacccccttagcggacgaggaactcgcgcgcaaattgcaggcgaaa
tgggacgaagaagctaaatccggtaatcagtgctctagtaacctccaggactaccagaat
ccgtcgacactggaagccaaacccgaagggcttacacaggaatttggcactcgactacag
actcatggtacccctgcgtgcggtgatgtttctgggaatgggaaaccgaatagagtctta
tcattacaaatctcttctagcgctgaggatactatttcccagtcgataccgtttgaccaa
agtcctctcacttttgaaccttcatcttatgcagagaatttgcgggcccactgggcgctc
gaagggggccacgcatcttatgccattcttacgagagcatttgttctcgtcaacaacact
caaagccggattaagattgtcgatacactagtcaatctcctgaggttactcatagaagct
gacccgggcagtctcgtttttgcagtgtggcttgcaaccaatgcgattgcccccccatat
gttccagtggagttagggttgggcgggtctgctatatcaaaagcattgaaaactgcatat
ggattaaacaaccaaggattgaaagctttgtgggacaagtttggtgatgcgggggatgtt
gccttcgaggcgaagaaaaggcagacgtttacgttaaggaagccaaaaccgctatcaatt
agaggagtctacgaatctctcttgaaaatttctagaagcaaggggccgggaagccaggaa
atcaaacaacgaatcgttgagaaactcctccaagatgcgcgaggcgcggaggaaagcaga
tacattgtgcgaacacttgtacagcatctccgcattggcgcggtgaaaacaaccatgctc
attgctctggctagagcttttctttactctagaccttctacgaaagatttctttgtatac
aaccgaatcgagctctcaaaactcaaaaaggaagaaatggcgagcatctacagcagggcg
gaggaaatcgtgaaagcttcttatgctcgacatcccagctacgacgatttagtatcatgt
cttttggaaatcggtatttcagatgagcttcttgtgagatgtgggctaactctccatgtg
ccattacacccaatgctgggaagcataacaagggatctaccgcaaatgcttaccaaactc
caagggagagcttttacctgtgaatataagtatgacggacaacgggcccaagtacactat
gattcttcaggcaaagtctccatcttttcacgacatctggaactcatgacggacaaatat
cctgatttggttgccctaatccctcggattcggggcgagggtgtatccagctttatttta
gagggggaaattgttgcggtgaaccaggaaactggggagctattggcatttcagactctt
accaaccgtgctaaaaagaatgttggtatcgagagcatcaagattagtatatgcttgttc
gcatttgatctcatgcttttgaatggtgaaccgttgctagagaggccactccgggagaga
cgggagctccttcgaggtctgttcatcgaggttccacaccatttcacttgggtcaaaaat
ctcgatgcgacatcgtctgattcggaagcggtgttgagttttttcaaggaagctactgat
gcgaaatgcgaggggctgatggttaagttgctcggtggttctgttcaacctgaattatct
aaagaggaatctgttgcagagccgaacctcaacagtgatttaatattaacaacaggccat
gttgaaccaaacggtaacaacaaaactagagctcggcgatccctgctctctacttatgag
ccagataagcggcttgaatcgtggcttaaagtgaagaaagattacagtgctgcatctgat
actttggacttaatcccgattgcagcttggcacggacaaggccggaaggccaaatggtgg
tctcctatccttcttgccgttcgaaatcttgaaactggcatgcttgaagctgtcaccaag
tgcatatccggtttcacagacaagttctatcaagcaaataaggaaaagtatgcagaaggg
agtgataatattatatcaagaccgagctatgtggactacagaagccaaccggaggtttgg
ttcgagccgcaggaagtctgggaagtagcatttgcagacattactctgagccccacgtac
acagcggcaattgggctcgttagcgatgagcgaggacttagccttcgattcccaagattt
gtcagagttcgtgaggataaagggcttgaagaagcaagtagttccgattatctggcgaat
ttatggcggaagcagaccgaacgacttcgggaagaaggggcaatagctaaccctatcgcg
gaaactgaccattttggatctgaggatgattga

DBGET integrated database retrieval system