KEGG   Paracoccidioides brasiliensis Pb18: PADG_11766Help
Entry
PADG_11766        CDS       T03549                                 

Gene name
PADG_04415
Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00730  Thiamine metabolism
pbn00790  Folate biosynthesis
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PADG_11766 (PADG_04415)
   00790 Folate biosynthesis
    PADG_11766 (PADG_04415)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbn04147]
    PADG_11766 (PADG_04415)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pbn00537]
    PADG_11766 (PADG_04415)
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PADG_11766 (PADG_04415)
Exosome [BR:pbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PADG_11766 (PADG_04415)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pbn00537]
 Enzymes
  PADG_11766 (PADG_04415)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 22587663
NCBI-ProteinID: XP_010759994
UniProt: A0A0A0HV89
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MSDPLLVQRSSSEHSSIRTGEADALLTGERTYRDEERSRSSIWRELGLFAWALFATVTVI
ILAVLYQHQVQKNASGPGKLGPGEKPTGKRNLIFMVSDGMGPASLSLTRNFRQFESHLPV
DDILVLDKHHIGTSRTRSSSSLITDSAAGATAFSCAKKSYNGAISVLPDHTPCGTVLEAA
KQAGYMTGLVVTTRITDATPACFASHANMRSYEDLIALHEIGEYPLGRMVDLMIGGGRCH
FLANSTKGSCRADDIDVVKLAKAKGFSYIDDWMGFDHLKMGENVDLPLLGLLAPKDIPYE
IDRRLLNNVYPSLEEMTRMALKALSKATEDSDKGFFIMIEGSRIDHAGHGNDPAAQVHEV
LAYDKAFSAVLEFLKKDSTPGILVATSDHETGGLSIARQLHPSQYPTYLWYPGVLANASH
SSEFLRNTLNAYLDGTGKGASGPERQEYVRKKLLADGLGIHDATDLEVDKLISGGGAYAF
ADMISRRAQIGWSTHGHSAVDVNIYASSPNDALSLMGNHENTEIGSFLADYLNIDLESVT
KQLQTTRSFSYDTDDGSVKPYAWMGPPLDDGVVVDKLDTYHGDFKRKKRDGLRQSYCS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctctactcgtccagcgctcctcctctgagcattcgtcgatacgaacaggc
gaggctgacgctctcttaactggtgaacggacgtaccgcgatgaagaaaggagtcgctcc
tccatatggcgtgagcttgggctctttgcctgggctctcttcgctaccgtcactgtcatc
atcctcgcagttctctaccaacaccaagtacaaaagaacgcatcaggcccagggaaattg
ggccctggagagaagcctacggggaagaggaatctgatattcatggtatctgatgggatg
ggcccggcaagtttatcgctgactcgaaatttccgacaattcgagagccacctgcctgtc
gatgatatcctcgtcctagataagcaccatatcggaacctcgagaactagatcctcatct
agcttaattaccgactctgcggctggcgcaactgcattttcctgtgcgaagaagagctat
aatggcgccatctctgttcttccggatcatactccgtgtggtacggttcttgaggccgca
aaacaagctggttatatgactggtctagtcgtaacaactcgaattactgacgctacacca
gcttgctttgcttctcatgctaacatgcggtcctacgaagatcttattgccttgcatgag
attggagaatatcctcttggtcgaatggttgacctaatgattgggggtggacgttgtcat
ttcttggcaaattccaccaaggggagctgccgtgcagatgacatagacgtggtgaagcta
gctaaagctaagggattctcatatatcgatgattggatgggatttgaccatcttaaaatg
ggcgaaaatgttgatctcccgcttcttggccttctggcaccaaaggacattccctatgaa
atagaccgccgcctgctgaacaatgtgtacccatctctagaggagatgacacgtatggct
ctaaaggcactaagcaaagctaccgaagatagcgacaaaggtttcttcatcatgatagag
ggttcaaggatagaccatgcaggccatggaaatgatccagcagcccaagtccacgaagtt
ctcgcttatgataaagcgttctccgcagttctggagtttcttaagaaagattctaccccc
ggaatcctcgttgccacgtcagaccacgagactggcgggttgtctatcgctagacaactc
cacccctctcagtatccaacatatctctggtatcctggagtgctcgcaaacgccagccat
tcctctgagtttcttaggaataccttaaatgcctatctcgacggcactggcaaaggtgca
agcggcccagagcgtcaagaatatgtccgcaaaaagctgctggctgatggattaggcatc
catgacgcaacggacttagaggttgataaactgataagcggtggtggtgcttatgctttt
gcagacatgattagtcgacgagcccaaattggctggtccacgcatggacattctgctgtc
gatgtgaacatctacgcctcctctcctaacgatgccctctccctaatggggaaccatgaa
aatactgaaattggctcattcctcgcggactatctcaatattgacctggagagcgttacc
aagcagctgcaaaccacacgttcgttttcatatgacaccgatgatggcagtgttaagcca
tatgcttggatgggcccaccactcgacgatggcgtagtcgttgataaactcgacacttac
catggcgatttcaaacgaaagaagcgtgatggacttcgtcaatcctattgttcttga

DBGET integrated database retrieval system