KEGG   Paracoccidioides brasiliensis Pb18: PADG_12481Help
Entry
PADG_12481        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbn03036]
    PADG_12481
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PADG_12481
Chromosome and associated proteins [BR:pbn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PADG_12481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 22588378
NCBI-ProteinID: XP_010763855
UniProt: A0A0A0HRZ3
LinkDB All DBs
Position
Unknown
AA seq 1179 aa AA seqDB search
MDRSHREHPSSPSPAAGLQGRLSTKHADKLASSFTRLSIATGSVIVSPSSTPSPSPYQSP
SRFIDRNIPFSRHNSPSRALANHPYVPRRTPSTSSLREERRGSTSSLQKRSSVSSLRSVQ
NYSGNGVTPQRPSLSRRASSNFLSTTSSSMRPKSPIVCPDSPIQPLVPTASSIANSHFKK
ELALHQSADLHSKTLVIVQDACYGHRFSRPRTSKAGLEQIVERPERLLASVLGVSTAYIR
MGRRYDDGQFAPHPDLDLRSLPIPPFQVRKTTRTMPINSPAVTHVHGIKWMDELRVMCDA
AESRLALNGKELVRPSSSGKDNHSSTSLPKLHEGDLYLCSESLNAFEGALGGVCEAVDVV
FGPTSTTRAFVSIRPPGHHCSADYPSGFCWLNNVHVGITHAAMSHGLTHAAIIDFDLHHG
DGSQEITWEQNRKAKTASKNAPLHKKMTIGYYSLHDINSYPCESGDLDKVRNASLCIDNA
HGQSIWNVHLEPWKSSASFWELYNEKYTILLEKARKFLRSHTLRLLNSQNQAPPKAAIFI
SAGFDASEWEGVGMQRHKVNVPTDFYAKFTSDIVRMSEEEGLGVDGRVISVLEGGYSDRA
LISGVLSHLSGLADSQTSIYENGDNRLATEMFGRLGLDDVPKAVPEEVSSFDTQWWKLPL
LEEIERLANPPPPPPAPTHKSLEKGPPTYCSPTQASAAKIVIPSRDRRSISSQLSAGDGG
YMRPPLPVIDWATAAYEMSKTLIPTDRQTVSFHHSELKAEGARTRRDRHSTSNFSELQPV
DDRRSMQLRERKLKSPSPELQITKRSSQALRRTTIASVSDLPESSTVTSSASSNQNLNHV
YSRNSRRLSVTSTVASTIGGNPSKGRVEGTSPSSNGDSNRTLNSLPGTSNRKPAELVTVK
SRVTGVRSSPRKAAPPPQARTIGGSPIPPFDSSSINTDTAEHELTKLSAGIKKLSIKLKV
PSPEEHVAREEERLKVSANKFTSRKTRKTQAPKTSRSRSTKSSAKTLRPGTSLGEAPAPP
VVLSAASGHVKQEAGPPAALANPDIEMIHTPDLTTTPFSAKLNNGAAISVWPSEPGMQQT
QQKPSKRLSPDGIFTPHISQPLTPRSRSLGNSQQPQTTIKSPPTSMGYKSATQQQQQQQQ
TTNTQLTVFTSTSAIPFATSSAVSSAAPPGPRQENRREQ
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggaccggtctcatcgagagcatcctagcagcccgtcgcctgcggccgggctccaaggg
aggctgtcaaccaaacacgcagacaaactggcaagctcctttactcgcctctcaattgca
acaggttctgttatagtcagtccatcctcgacgccttccccttcgccgtaccagtcacct
tctcgtttcattgacaggaacattcccttctcacgtcataactcgccgtcgagagctcta
gccaaccacccgtacgttcctcgaaggacccccagtaccagttcgttgagagaggaaaga
agaggttctacctcgtctcttcagaaacgatcatcggtcagctcactacgatctgttcaa
aactatagtggaaacggtgttaccccccagcgacccagcctatcgcgacgtgcctcttca
aacttcctttctaccacatcttctagcatgcgccccaagtcccccatagtgtgccctgat
tccccgatccagcctttggtgccaaccgcctcctccatcgccaatagccatttcaagaag
gagttggctttgcatcaatccgcggacctgcactccaaaactctcgtcattgtacaagat
gcctgctacggacacaggttttcgcgcccaagaacctccaaggccggcttggaacaaatt
gtcgaacgcccagagcgcttacttgctagtgttctgggtgtatcaaccgcatatattcgt
atgggaaggaggtatgatgacggccagtttgcaccacatccggaccttgatcttcggtca
cttcccatcccaccctttcaagtccggaagacgacgcgcactatgccaattaattcccct
gcggttacacatgtccatggaataaaatggatggacgaactacgagttatgtgtgatgcc
gccgaatctcgtcttgcattgaatggaaaggagttggttcgccccagcagttcagggaag
gacaatcatagctcaacaagcctcccaaaactccacgagggcgacctgtatttgtgttca
gagtccctgaatgcctttgaaggtgcgttgggaggagtctgcgaagcggtagatgtcgtg
tttgggccgacgtcgaccactcgcgctttcgtgagcattcgacctcccggccaccattgt
tcagcagactatccatccgggttttgctggcttaataatgttcatgttggtattactcat
gctgcaatgtctcatggtctcactcatgctgcaatcattgattttgatttacaccacgga
gacggatcgcaggagattacttgggagcagaaccggaaggcaaaaaccgcttcgaaaaac
gctcctctgcacaagaagatgaccatcggctattacagtctgcatgacattaactcgtat
ccttgtgaaagcggcgacctggacaaagttcgtaatgctagcctctgtatcgacaacgcc
catggacagtctatctggaacgtccatctagaaccctggaaaagttcggctagcttttgg
gagctgtataatgaaaaatatacaattcttcttgaaaaggctcgaaagtttcttagatcc
cataccctacgtttgttaaattcacaaaatcaggcaccacccaaggcagcaatattcata
tcagcaggtttcgatgctagtgagtgggaaggagttggtatgcaacgacacaaggtcaac
gtacccacggacttttatgccaagtttacttcagatattgtacggatgtctgaagaggaa
ggtttaggtgttgatgggagggttattagtgttctggaagggggatactctgacagagct
ctaatcagtggtgtgctcagccatctctcagggcttgcggatagccagaccagcatttat
gaaaatggagacaaccgccttgctactgagatgtttggtcgccttggtttggatgatgtt
cccaaggcggttccggaggaagtttcttcatttgatactcaatggtggaaacttcctctg
ctagaagaaatagaacgtcttgcaaacccaccaccaccacctccagccccaactcacaaa
tctcttgaaaaaggacctcctacatattgttctcccacgcaggcgtcagcggccaaaatc
gtcatcccctcgcgagaccgcagatcaatttcatctcagctaagtgctggtgacggtggt
tacatgcgcccacccctcccggtcattgactgggcaacggcggcgtatgagatgtcgaaa
accctcattcctacagaccgccagacagtgagcttccaccactcggagctgaaggctgaa
ggtgctcgtacacgacgggaccggcactcaacttcgaatttttcagaattacagcctgta
gatgacaggagatctatgcagttgagggagagaaaactaaagtcaccctcgccggagcta
caaattaccaaacggtcttctcaagctttgcgacgaaccaccattgcatcagtcagtgac
ctacccgaatcatctaccgtcacatcttctgcaagtagcaaccaaaatttgaaccatgtt
tattctcggaattcacgacgactaagtgtaacctcgaccgtggcatccactatcggtgga
aaccctagtaagggcagagtggaaggaacttcaccatcttcaaatggggatagtaaccgc
acgctaaattcactcccaggaacttcaaacaggaagcctgcggaattggtaacagttaaa
tcccgagttacgggtgtccggtctagtccaagaaaagcggcaccacccccacaagcacga
acgatcggtggaagtccaattccacccttcgattcatcttctatcaatacggatacagca
gagcatgaactaactaaactttccgccggtattaagaaattaagcattaagcttaaagtt
cccagcccagaagagcatgtagccagagaagaggagcgactgaaagttagcgcaaacaaa
ttcacctccagaaagactagaaagactcaagcacccaaaacgtctagatcaagaagcacg
aaatccagcgcgaagacactacgccctggcacctcgttgggcgaggctcctgcccctcct
gttgtactatctgctgcttcgggtcatgttaagcaggaagcgggtccccctgcggcactt
gcaaaccctgacattgaaatgatccataccccagatttaacgactacaccattctccgcc
aagttgaataatggggcagctatatctgtatggccatcagaaccaggaatgcagcagacc
caacagaagccttcgaagcgcttgtcacctgatgggatcttcacacctcatatttcccaa
cctctcactcctcgatctcgatccctcggaaactcgcagcaacctcaaaccaccatcaag
tcaccgcctacctcgatgggctataagtctgctacacaacagcaacagcaacagcagcaa
actactaatacacaacttactgttttcacgtccacttccgctatacctttcgctacttca
tccgccgtttctagtgcggcccctccaggcccacgccaggagaatcgtcgagagcagtga

DBGET integrated database retrieval system