KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_03800Help
Entry
PACID_03800       CDS       T02345                                 

Definition
(GenBank) Uronate isomerase
  KO
K01812  glucuronate isomerase [EC:5.3.1.12]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00040  Pentose and glucuronate interconversions
pbo01100  Metabolic pathways
Module
pbo_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
pbo_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PACID_03800
Enzymes [BR:pbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.12  glucuronate isomerase
     PACID_03800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UxaC
Motif
Other DBs
NCBI-ProteinID: AFV88226
UniProt: K7RPH6
LinkDB All DBs
Position
429309..430475
Genome map
AA seq 388 aa AA seqDB search
MFLDEEFLLTTPTARTLFHDYAEHQPVIDYHCHLNPSEIAEDKNFSGIVEAWLGGDDYGD
HYKWRLMRANGVSEELVTGKGDDWEKFQAFAGAMEKAIGNPVYLWTHLELRRIFGIEKDL
NRSTAREIFDRTNELLASPEFSRRGLIRKFNVEAVCTTDDPADDLGFHQQLAGEKDFKVL
PAMRPDKALNIDRPGFGEWVTRLEGAVGHPVSGFDGLTAAIDERVGFFHEMGGRLSDHAL
DVVEYAEATPAELDVIVDRARSGAGLSALEDPRAAGGRRSRADERHGMRRHARVPTRHTR
PHHDVRRHPRSGRGGGEHVPGAQRPDAGQGAGLRSRRAPDVARPACGPRLDCGASPRVAA
SRNSRARSRIHRGTGVLVLPEPRRAVAR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgacgaggaattcctcctcaccacgccgacggccaggacgctgttccacgac
tatgcggagcaccagcccgtcatcgactaccactgccacctcaacccctccgagatcgcg
gaggacaagaacttctcggggatcgtcgaggcctggctgggcggcgatgactacggggat
cactacaagtggcggctgatgcgggccaacggcgtctctgaggagctggtgactggcaag
ggcgacgactgggagaagtttcaggccttcgccggggccatggagaaggcgatcggcaat
cccgtctacctgtggacccatcttgagttgcgccgcatcttcggtatcgagaaggacctc
aaccgcagcaccgcccgcgagatcttcgaccgcaccaatgagctgctggccagcccggag
ttctcccggcgcgggctcatccgcaagttcaacgtcgaggccgtctgcaccaccgacgac
ccggccgacgacctgggcttccaccagcagctggccggcgagaaggacttcaaggtgctg
ccggcgatgcgtcccgacaaggccctcaacatcgacaggcccgggttcggggagtgggtc
acccggctcgagggggccgtcgggcatccggtgagcggattcgacgggctgaccgcggcc
atcgacgagcgggtcggcttcttccacgagatgggcggccggctctccgaccacgccttg
gacgtcgtcgagtacgcggaggcgacgccggccgagctggacgtcatcgtcgatcgggcg
cgctccggcgccgggctgagtgcgctggaggatcctcgtgcggcggggggccgacgttcc
cgcgcagatgagcgtcatgggatgcgacgacacgctcgcgtcccaactcgccacacccgc
cctcaccacgatgtacgtcgacatccgcggagcgggcgaggcggcggtgaacatgttcct
ggagctcagcggccggacgccgggcaaggggcgggtctccgatctcgccgagcaccggac
gttgcccgtccagcttgtggtccgcgactcgactgcggcgcctcgccgcgcgtagcggcg
tcacggaacagccgggcacgctcccggatccaccgcggaactggcgttctcgtcctaccg
gagccaagacgtgccgttgcgcggtga

DBGET integrated database retrieval system