KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_12490Help
Entry
PACID_12490       CDS       T02345                                 

Definition
(GenBank) Kinase domain-containing protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbo01001]
    PACID_12490
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PACID_12490
Protein kinases [BR:pbo01001]
 Serine/threonine kinases: Other
  Bacterial family
   PACID_12490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal Kdo RIO1 Haspin_kinase PIP49_C
Motif
Other DBs
NCBI-ProteinID: AFV89071
UniProt: K7RRT6
LinkDB All DBs
Position
complement(1364024..1365484)
Genome map
AA seq 486 aa AA seqDB search
MSMTVSTDPLVGRVLGGRYEITSRIARGGMATVYRAQDTHLRRGVAVKVMHEGLYEDEEF
ARRFDLEAKAAARLVNPHVVSVFDQGVDDMRPYIVMEYVPGCTLRHVIVQEAPLTPRHAL
AMLEPVVSALASAHDDGLVHRDVKPENVLISDRGQIKVADFGLARAVTAQSATATGLLVG
TVSYLPPELVVSNRADERSDVYSTGIVLFEMLTGHKPHTGDTPIQVAWAHVHEDVPAPST
YLAGDGRRGRELAEHIPAYLDALVRTCTARDPSDRPADGRVLLGLIRSARVSLAQGRTDD
PAITSLMHRGGGPRPTSPVPAPGAPTGSPARTRTPVSPIDRAGAVRPGAVATPRTDASHR
PDASHRAVSPRTPREAPNPTIRSAAPTRPRNPGAARTPRAGTVPTARVRSGRAPAPARTR
NSYRGRRNLIAMLLITALAVTVGLLAYRFGVSLRTAASSVAVSGAAGSSSATAAPLAGPE
DPPSIR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgactgtgagcaccgaccccctcgtgggtcgcgtcctcggcggtcgctacgag
atcacctcgcgcatcgcccgtgggggcatggcaaccgtctaccgggcccaggacacccac
ctccggcggggtgttgcggtcaaggtgatgcacgagggcctctacgaggacgaggagttc
gcccgtcgcttcgacctcgaggccaaggccgcggcccgtctggtgaatccccatgtggtc
agcgtcttcgaccagggggtcgacgacatgcggccctacatcgtcatggagtacgtgccc
ggctgcacgttgcgccatgtcatcgtccaggaggcgccgctgaccccccgccatgcgctg
gccatgctcgagccggtggtctcggccctggccagcgcccacgacgacggcctggtgcat
cgcgacgtcaagcccgagaacgtcctgatctccgaccgcggtcagatcaaggtggccgat
ttcgggctggcccgggctgtcaccgcgcagagcgccacggcgaccgggctgctggtcggc
acagtctcctacctgccgcccgagctggtggtgagcaatcgcgccgacgagcgctccgac
gtctactcgaccgggatcgtgctcttcgagatgctgaccggccacaagccgcacaccgga
gacactccgatccaggtggcctgggcccacgtccacgaggatgtccccgccccgtcgacc
tacctggccggggacggccgcaggggccgcgaactggccgagcacattccggcctacctc
gacgccctggtacgcacctgcaccgcccgcgatccctccgaccggccggccgacgggcgg
gtcctgctcggcctgatccgttcggcccgggtctccctggcccagggaaggaccgacgac
cccgcgatcacatcgctgatgcaccgcggcggcggcccccggccgaccagtccggtaccc
gccccgggggcgccgaccggttcgcccgcccgcacgcgcaccccggtctccccgatcgat
cgtgcgggcgcggtgcgccccggggccgtcgcgaccccccgcaccgacgcctcgcaccgc
cccgatgcctcgcaccgcgcggtctctccccggaccccccgggaggccccgaacccgacg
atcaggtccgccgctcccacccgtccccgtaatccgggggcggccaggactcctcgggcg
ggcactgtgccgacggcgcgggtccgctcggggagggccccggcgccagcccgcacccgg
aactcctatcgaggacggcgcaacctcatcgcgatgctgctcatcaccgctctggcggtg
accgtgggcctgctggcctaccggttcggggtgtcgctgcggaccgcggcgtcatccgtg
gccgtctcgggagccgctgggtcgtcctccgccacggccgcgcccctggccggaccggag
gatcccccgtcaatccggtga

DBGET integrated database retrieval system