KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_16740
Entry
PACID_16740       CDS       T02345                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00620  Pyruvate metabolism
pbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PACID_16740
Enzymes [BR:pbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     PACID_16740
SSDB
Other DBs
NCBI-ProteinID: AFV89482
UniProt: K7S4F9
LinkDB
Position
1768378..1771776
AA seq 1132 aa
MAHPQMINQANLRLAINGLPIPASGASDDIGVIAPVLARQRELRRELPEVLCPADRRIQG
FLDRYLEAAGVESRPQLPESTLTLDEAGLARTLSLPVDADEFSSDLVESYRVANGVLHNP
RNDRRTTAGVFHIAEGGLAIPDDKKAVPAAVFARLLELAFQAPAADTLLPYTATQDAEHR
AHTWVSLLMRPIVVPEVPGLVTERRMETRFFVPGGLVSNLDFVEGIFGNAGDPLLPANDA
ALAPTGWTGHTGCVILAPHLNRVTKKDLGLPHVDQATERQRRDGMCWADRAECYNDGKPF
KLCVRDESGVILTIIADNYFGYCKKEVKTQIGYSANLFGLSEEEHSGGARAYTSHNEGLE
YTVEAEAGDPSVADVVAANPGHFETDPNGSAVSTDIADVLLVPVPARFSLREGTVSWDTD
GVEQSVRLRPDHEYLTPTGTRMRIEHSEIDNQWALIATEGASTTLHKQCTVSGGGKSEIS
KAISDAFIPGNAYVPDFEADMAAVDDILNRDFSMRFADPALAGTDHRPILSGERSVGSVI
KLLTVSADFTDDYNAWIDAIPQFRKELVFTIKRYYKPEWGTDWKSHFTVAPTNGRHGNMV
RLDGEKIRVDMLRVGFDEHGAWRLFTLRHDYAPAVKVQTEDDMTASAVVPAGLTVGPAGL
SSKVVTNCEALLFQRPDDAIYRGYDTQTERDMSGSGLFISNYQPLTRADVAAMREDVVAF
SQFSAPMRQFLSDFADSDPATEPKYVVSSADPRLIDGVRSKNPRYLQVRPDIAHPRDTAI
AGLASHLYHRRSLDEKLPLPVDVVPAGRRNNPPEGKIPALCSYNPLHYMELPELFMEFIS
SMTGKSPSTTGAGSEGALTKAPFNAMPAVFDLNSSFLSFVLSGYDGWLSSAGCIGPKVQV
AHDISLLVPELFSRMSPDERDAGTLIAGGYLEKLEDYDFEGETVLASRLGYRMTEKFMKI
YFGRIFMHPDTIFTPEMLRPELQDPKVFADSVRTISATHARVARAYFDDGTVAMAVPPIR
ALLEIMANGATSEGWTLDDPELRGMFTRESVLASDWYAARLDAKQAEDIARSEAGMAHLQ
EFISDPRNEIACTEIDAQSRLESVRTYHDTVTSPDYRRLLVGTLGRQADYRF
NT seq 3399 nt   +upstreamnt  +downstreamnt
atggcccacccgcagatgatcaatcaagccaacctgaggctcgctatcaacggtcttccc
attcccgccagcggcgcatccgacgacatcggggtgatcgccccggtgctggcccggcag
agggagctgcgccgggagctgccggaggtgttgtgtccggccgatcggcggatccagggg
ttcctggaccggtatctggaggcggccggcgtggagtccaggccccagctgccggagtcg
acgttgaccctggatgaggcgggtctggccaggaccctgtcgttgccggtggatgccgac
gagttctcctcggatctggtggagagctaccgggtggccaacggcgtcctgcacaatccg
cgcaacgacaggcgcacgacggcgggggtgttccacatcgccgagggcggcctggccatc
cccgatgacaagaaggcggtgccggccgcggtcttcgcccgactgctggaactggccttc
caggccccggcggccgacaccctgctgccctacaccgccacccaggacgccgagcacagg
gcccacacctgggtgtccctgctgatgcggcccatcgtggtgcccgaggtgccgggcctg
gtgaccgagcgccgcatggagaccaggttcttcgtgcccggcggtctggtgtcgaatctg
gacttcgtggaggggatcttcggcaatgcgggggatccgctgctgccggccaatgacgcc
gccctggcgccgaccgggtggaccggtcacaccggatgcgtgatcctggcgccgcatctg
aaccgggtgacgaagaaggatctgggtctgccccacgtcgaccaggccaccgagcggcag
cgccgcgacggcatgtgctgggccgaccgggccgagtgctacaacgacggcaagcccttc
aagctgtgcgtccgcgacgagtccggggtgatcctgacgatcatcgccgacaactacttc
ggctactgcaagaaggaggtcaagactcagatcgggtactcggcgaatctgttcggcctg
tccgaggaggagcactcgggcggggcgagggcctacacctcccacaacgaggggctggag
tacaccgtcgaggccgaggccggggatccctcggtggccgacgtcgtggccgccaacccg
ggccacttcgagaccgacccgaacgggtcggcggtcagcactgacatcgccgacgtgctg
ctggtcccggtcccggcccggttcagcctgcgcgagggcaccgtctcctgggacaccgac
ggggtcgagcagtcggtgcggctgcggcccgaccacgagtacctgactccgaccgggacc
aggatgaggatcgagcattccgagatcgacaatcagtgggcgctgatcgcgaccgagggg
gcctccacgactctgcacaagcagtgcacggtctccggcggcgggaagtcggagatctcc
aaggcgatctcggacgccttcatccccggtaacgcctatgtgcccgatttcgaggccgac
atggcggcggtcgacgacatcctgaaccgggacttctcgatgcgcttcgccgatccggcg
ctggccggcaccgatcaccgcccgatcctctcgggtgagcggtcggtgggatcggtgatc
aagctgttgacggtctcggccgatttcaccgacgactacaacgcctggatcgatgcgatc
ccgcagttccgcaaggaactggtgttcaccatcaagcgctactacaagccggaatggggc
accgactggaagtcgcacttcacggtcgccccgaccaacgggcgccacggcaatatggtg
cgcctggacggggagaagatccgcgtcgacatgctgcgggtcgggttcgacgagcacggg
gcctggcggctgttcaccctgcgccacgactacgccccggcggtcaaggtgcagaccgag
gacgacatgacggcctccgcggtggttccggccggcctgacggtgggccctgcggggctg
tcgagcaaggtggtgaccaactgcgaggcgttgctgttccagcgtcccgacgatgccatc
taccgcggctacgacacccagaccgagcgggacatgtcgggttcggggctgttcatctcg
aactaccagccgctgacccgcgccgatgtggccgcgatgcgggaggacgtggtggccttc
agccagttctcggcgccgatgcgccagttcctctccgacttcgccgattctgatcccgcc
acggagcccaagtacgtggtctcctcggcggatccccggctcatcgacggggtccgctcg
aagaacccccggtacctgcaggtgcgccccgacatcgcgcatccccgtgacaccgcgatc
gccggcctggcctcccacctgtaccaccgccggagcctcgacgagaagctgccgctgccg
gtcgatgtggtgccggcggggcggcgcaacaatccgcccgaggggaagatcccggcgctg
tgctcctacaacccgctgcactacatggagctgcccgaactgttcatggagttcatctcc
tcgatgaccggcaagagcccctcgacgaccggtgcgggatcggagggggcactgaccaag
gccccgttcaacgcgatgccggccgtcttcgacctcaactcctccttcctgtccttcgtg
ctgagcggctatgacggctggctgtcgtcggccggctgcatcggcccgaaggtgcaggtg
gcccatgacatctcgctgctggtgcccgaactgttcagtcggatgagccccgacgagcgc
gacgccgggaccctgatcgccgggggctacctggagaagctggaggactacgacttcgag
ggcgagacggtgctggcctcccggttgggctaccggatgaccgagaagttcatgaagatc
tacttcgggcggatcttcatgcaccccgacacgatcttcacccccgagatgctgcgccca
gaactgcaggatccgaaggtcttcgcggactcggtgcgcaccatctccgccacccatgcc
cgggtggcgagggcctacttcgacgacgggaccgtggcgatggccgtcccgccgatccgg
gcgctgctggagatcatggcgaacggggccacctcggagggctggacgctggacgacccg
gagctgcgcggcatgttcacccgggagtcggtgctggcctccgactggtacgccgcccgg
ctggacgccaagcaggccgaggacatcgcccgctcggaggccgggatggcccatctccag
gagttcatctccgacccgcgcaacgagatcgcctgcaccgagatcgacgcgcagtcccgt
ctggagtcggtgcggacctatcacgacacggtcacctctcccgactaccgacggctgctc
gtcgggactctcggccggcaggccgactaccggttctga

DBGET integrated database retrieval system