KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_18390Help
Entry
PACID_18390       CDS       T02345                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00250  Alanine, aspartate and glutamate metabolism
pbo00410  beta-Alanine metabolism
pbo00430  Taurine and hypotaurine metabolism
pbo00650  Butanoate metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
pbo02024  Quorum sensing
Module
pbo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PACID_18390
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PACID_18390
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PACID_18390
   00430 Taurine and hypotaurine metabolism
    PACID_18390
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PACID_18390
Enzymes [BR:pbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PACID_18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DotU
Motif
Other DBs
NCBI-ProteinID: AFV89643
UniProt: K7RXC8
LinkDB All DBs
Position
1952554..1953960
Genome map
AA seq 468 aa AA seqDB search
MTPHRISGQQRHRKASPVELNPVFVRPGESSEVPKMRIPRDESLPETAYQIVHDEAMLDG
NARLNLATFVGTWMEDEANRLYLEAADKNMIDKDEYPRTAEIESRCATMLADLWHAPDPE
RAVGTSTIGSSEACMLAGLALKRRWQHARRAAGKPADRPNLVMSSAVQVCWEKFCNYWDV
EMRQVPVSMEHKVLDGDGLDGYVDENTIGVVAILGVTYTGMYEPVARIAEALDRIQARTG
LDVKIHVDGASGAMVAPFIQPELEWDFRVDRVVSINTSGHKYGLVYPGLGWIVWREAQCL
PEDLVFRVSYLGGDMPTFALNFSRPGAQVLLQYYLFLRLGFTGYRRVQQTCSDVATYLAR
EIGSMPAFDLWNDGSDIPVFAWRLHRGHTENWTLHHLGDRLRMRGWLVPAYPMPADLEEI
TVQRVVVRNGFSRDMADAFLADLREEVGYLDSLDSPMPGTGHPQAFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcaccgcatctcaggacagcagcgccaccggaaggcgtcaccggtcgaactg
aatccggtcttcgtcaggccgggggagtcgtccgaggtcccgaagatgcggattccccgt
gacgagagcctgccggagaccgcctaccagatcgtccatgacgaggccatgctggacggc
aatgcccggctcaacctcgccaccttcgtcggcacctggatggaggacgaggccaatcgc
ctctacctggaggctgccgacaagaacatgatcgacaaggacgagtacccgcggacggcc
gagatcgagagccgctgcgcgacgatgctcgccgacctgtggcacgcccccgatcccgag
cgcgccgtcggcacctccacgatcggctcctcggaggcctgcatgctggccggactcgcc
ctcaaacggcggtggcagcacgcccgcagagccgccgggaagcccgccgaccggccgaac
ctcgtgatgtccagcgcggtgcaggtctgctgggagaagttttgcaactactgggacgtc
gagatgcgccaggtacccgtctcgatggagcacaaggtgctcgacggcgacgggctggac
ggctacgtcgacgagaacaccatcggtgtggtggcgatcctcggggtcacctacaccggg
atgtacgagccggtcgcccgcatcgccgaggcactcgaccgcatccaggcccggaccggc
ctggacgtcaagatccatgtcgacggggcctccggcgcgatggtggcccccttcatccag
cccgagctggaatgggacttccgggtcgacagggtggtctccatcaacacctccggccac
aagtacggactggtctacccgggcctgggctggatcgtctggcgggaggcccagtgcctg
cccgaggacctcgtcttccgggtgagctacctgggcggcgacatgcccaccttcgcgctg
aacttctcccggcccggcgctcaggtgctgctgcagtactacctgttcctgcggctcgga
ttcaccggctaccggcgcgtccagcagacgtgcagcgacgtggcgacctacctggcccga
gagatcggatcgatgcccgccttcgacctgtggaacgacggctccgacatcccggtcttc
gcctggcgtcttcaccgggggcacaccgagaactggactctccatcacctgggagaccgg
ctgaggatgaggggatggctggtgcccgcctacccgatgccagccgacctggaggagatc
acggtgcagcgggtggtggtgcgcaacggcttcagccgcgacatggcagacgccttcctg
gccgacctgcgcgaggaggtcggctacctggactccctggactccccgatgccgggcacc
gggcatccccaggccttccaccactga

DBGET integrated database retrieval system