KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_27300Help
Entry
PACID_27300       CDS       T02345                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PACID_27300
Enzymes [BR:pbo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PACID_27300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 HI0933_like DAO Thi4 NAD_binding_8 FAD_binding_3 Glutaredoxin K_oxygenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFV90497
UniProt: K7S7C4
LinkDB All DBs
Position
2876962..2878554
Genome map
AA seq 530 aa AA seqDB search
MLDSALTHQLADYLEMTTEPVALVPSPGEGRKSSQMMELLGEIAALSDDVTVTEPVADPR
TPSFAITRPGTGISVRFAGLPMGHEFTSLVLALLQVGGVPVKEDPALIDAVRSVKGHHEF
TTYMSLTCQNCPTVVQALNAMSIINPNIRHTAVEGGTFKAEVDDLGIQSVPAIHLDGREW
GSGRMTMADILEKLDSSAAGQAAEDLSGRDPYDVLVVGGGPAGAAAAVYAARKGIRTAMV
GDRIGGQVLDTDAIENLISVPHTTGPRLAAALGAHVAEYGVDTIERQRAEELIPAGPDGL
TAVRFTGGQLRARSVILATGARWRHLGVPGEDEYRTRGVTYCPHCDGPLFAGKDVAVVGG
GNSGIEAAIDLAGVARHVTVVEFLDDLKADAVLLEALGKLPNASVIASARTTRVIGDGAH
VTGLEYEDRTTGRTGSLDVEGIFVQIGLLPNTEWLGDAVKLTRRGEIVVDARKATSVPGV
YAAGDCTTQPYKQIIISMGAGAMASLAAFDHLIRSAGAAGTIPTPLAQAS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgactccgccctcacccaccagctcgccgactacctggagatgaccaccgagccg
gtggctctggtcccctcccccggggaggggaggaagtccagccagatgatggaactgctc
ggcgagatcgctgctctcagcgacgacgtcaccgtcaccgaacccgtcgccgacccccgc
accccgtccttcgccatcacccggcccggaaccggcatctccgtgcgcttcgccggactg
ccgatgggccacgagttcacctccctggtgctggccctgctccaggtcggaggggtcccg
gtcaaggaggatcccgccctgatcgacgccgtgcgaagcgtcaaggggcatcacgagttc
accacctacatgtcgctcacctgccagaactgccccaccgtcgtgcaggccctcaacgcc
atgagcatcatcaaccccaacatccgccacaccgccgtggagggcggcaccttcaaggcc
gaggtcgacgacctcggcatccagtcggtgcccgccatccacctcgacggccgggagtgg
ggatcgggccggatgacgatggccgacatcctggagaagctcgactcctcggccgccggg
caggccgccgaggacctgtccgggcgcgacccctacgacgtcctggtcgtgggtggtggc
ccggccggtgcagcggccgccgtctacgccgcccgcaagggcatccgcaccgccatggtg
ggcgaccggatcggcgggcaggtgctcgacaccgacgccatcgagaacctcatctcggtc
ccccacaccaccgggccccggctggccgcggcgctcggcgcccacgtcgccgagtacggc
gtcgacaccatcgagcgccagcgagccgaggagctcatccccgcaggcccggacggcctg
accgccgtacggttcaccggcgggcagctgcgcgcgaggtcggtcatcctggccaccgga
gcccgctggcgccatctgggggtccccggcgaggacgagtaccgcaccaggggcgtcacc
tactgcccccactgcgacggccccctgttcgccggcaaggacgtcgccgtggtcggaggc
ggcaactcgggcatcgaggccgccatcgacctggcaggggtcgcgcgtcacgtgaccgtc
gtcgaattcctggacgacctcaaggccgacgccgtcctgctggaagcactcggcaagctg
cccaacgccagcgtcatcgcctcggcccggaccacccgggtgatcggcgacggggcccat
gtcaccggcctcgagtacgaggaccgcaccaccggccggaccggcagcctggatgtcgag
ggaatcttcgtccagatcggcctgctgcccaacaccgaatggctcggcgatgcggtcaag
ctcacccgccgcggtgagatcgtggtggacgcccgcaaggccacctcggtgcccggcgtc
tacgccgccggggactgcaccacccagccgtacaagcagatcatcatctcgatgggggca
ggggcgatggcctcgctggccgccttcgaccatctgatccgctcggccggtgccgcgggc
accatcccgactccgctcgcccaggcgtcctga

DBGET integrated database retrieval system