KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_30260Help
Entry
PACID_30260       CDS       T02345                                 

Definition
(GenBank) Oxidoreductase, zinc-binding dehydrogenase family protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00040  Pentose and glucuronate interconversions
pbo00051  Fructose and mannose metabolism
pbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PACID_30260
   00051 Fructose and mannose metabolism
    PACID_30260
Enzymes [BR:pbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     PACID_30260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFV90791
UniProt: K7RWJ2
LinkDB All DBs
Position
3196357..3197406
Genome map
AA seq 349 aa AA seqDB search
MTETMTAAVMHAVGDIRIEEVPKPVAGPGEALLKVAACGVCGSDLARMFLKGPHKLPLIC
GHEFSAWVEEVGEGVTSVKPGDLVTVPPMLPCFKCPPCVQGEFSLCEDYDYYGSRRDGAY
AEYVAGPADLLLKAPEGLDPRAAAMVDPSAIALHAIWRTKLRAGQRVAVMGGGGPIGLFA
VQWAKIMGAAEVVAVDVSDEKKKLALEAGADAAVSTGPELDELTGTGFNCVVETSGVPAV
EDIAVGITARHGSAVFIGIPNAPVTISKANWDRMMRLEIDVQGSWNSFSAPFPGAEWTTT
LHHMAAGNLKWEFMITHEEPVEKVPELIKAMAERTVFSSKVLFLPNGTL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacgatgacagcggccgtgatgcacgcggtgggagacatccgcatcgaggag
gtccccaagccggtggccggccccggtgaggcgcttctcaaggtggccgcctgcggcgtc
tgcgggtcggacctggcccgcatgttcctcaagggcccgcacaagctgccgctcatctgc
ggccacgagttctccgcctgggtggaggaggtcggtgagggggtgacgtcggtgaagccc
ggcgatctggtcaccgtgccaccgatgctgccctgcttcaagtgcccgccctgcgtccag
ggggagttcagcctctgcgaggactacgactactacggttcccgtcgcgatggcgcctac
gccgagtatgtcgcagggccggccgacctgctgctgaaggcgcccgagggcctggatccg
cgggccgccgcgatggtggacccctccgccatcgccctgcacgccatctggcgcacgaag
ctgcgcgccggccagcgggtcgccgtgatgggcggcggcggaccgatcggcctgttcgcc
gtccagtgggcgaagatcatgggggccgccgaggtggtggccgtcgacgtctccgacgag
aagaagaagctggccctggaggccggggccgacgccgccgtcagcaccggtcccgagctc
gacgagctcaccggaaccggcttcaactgcgtcgtggagacctcgggcgtgcccgccgtc
gaggacatcgcggtcggcatcaccgccaggcacggctcggccgtgttcatcggcattccg
aacgccccggtcaccatctccaaggcgaactgggaccgcatgatgcgtctggagatcgac
gtccagggctcctggaactccttctccgcgcccttcccgggagccgagtggacgaccacc
ctgcatcacatggccgccgggaacctcaagtgggagttcatgatcacccacgaggagccc
gtcgagaaggtgcccgagctcatcaaggcgatggccgagcgcaccgtcttctcctccaag
gtgctgttcctcccgaacgggacgctgtga

DBGET integrated database retrieval system