KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_33140Help
Entry
PACID_33140       CDS       T02345                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00010  Glycolysis / Gluconeogenesis
pbo00030  Pentose phosphate pathway
pbo00051  Fructose and mannose metabolism
pbo00052  Galactose metabolism
pbo00680  Methane metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
pbo01130  Biosynthesis of antibiotics
pbo01200  Carbon metabolism
pbo01230  Biosynthesis of amino acids
pbo03018  RNA degradation
Module
pbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_33140
   00030 Pentose phosphate pathway
    PACID_33140
   00051 Fructose and mannose metabolism
    PACID_33140
   00052 Galactose metabolism
    PACID_33140
  09102 Energy metabolism
   00680 Methane metabolism
    PACID_33140
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PACID_33140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbo01009]
    PACID_33140
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pbo03019]
    PACID_33140
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PACID_33140
Protein phosphatases and associated proteins [BR:pbo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PACID_33140
Messenger RNA biogenesis [BR:pbo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PACID_33140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFV91072
UniProt: K7S938
LinkDB All DBs
Position
3517403..3519682
Genome map
AA seq 759 aa AA seqDB search
MRNDDRDDQRIFDRTSRTPTLPDGRGIRIGILTSGGDAQGMNAAVRAVVRSAISVGAEVY
AIYEGYQGMIDGGDGIRKFGWDDVGSILNRGGTVIGTFRSKEMREREGRLKAVRHLLHRG
IDRLVVIGGDGSLTGLNLLRNEWSGLVAELVERGDLAPEVAEQHPSLMIAGLVGSIDNDL
VGSDMTIGADTALHRIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMSAVAGGADYVL
VPEQPPAPGWEDEMCAELRKGRESGRRDSIVIIAEGATDREGNPIRAEYVRKVLAERLNE
DARVTILGHVQRGGKPSAYDRWASTWLGYSAVHEVLTATPESEGMVVGTRSNRSERLSLV
KAVADTQHVPELIEAGQYHEAMRMRGGSFLEMDAIFSELADPARTTPEPDYRRIAVMHAG
GPAPGMNTAMRALVRLGISRGHTMIGIHNGFVGLAANDMEEITWSQVEGLTGEGGAMLGT
RREVPQTQDLYAISRALEKNDIDALVVIGGYSAYDGVHKMTTERDRYPAFRIPTVCVPAS
IDNNLPGSELSIGTDTALNVIVDAMDKIKESGIASKRCFVVETMGKNCGYLAMMSGIAAG
AERIYLNEDGISLDDLVTDVHWLRESFAKGRRLFLAVRNENASKNYTTEFLAQMMEEESH
GMYDVRTAVLGHMQQGGSPSPFDRLLATRFSYQALNLVDDELAVGQVGSWFMGIREGSTH
AGKMETMSSLVDPQHRRPRHQWWLDLRTVARTLSDELRS
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaatgacgatcgtgacgaccagcgcatattcgaccggacctcccggacgccgacc
ctccccgacggcaggggaatacggatcggcatcctcaccagcgggggcgacgcccagggc
atgaatgccgcggtccgcgccgtggtgcgctcggccatcagcgtgggcgccgaggtctac
gccatctacgagggctatcaggggatgatcgacggcggcgacggcatccggaagttcggc
tgggacgacgtcggctccatcctcaatcgcggcggcaccgtcatcggcaccttccggtcg
aaggagatgcgcgagagggagggccgcctcaaggccgtccggcatctgctgcaccggggc
atcgaccgcctcgtcgtcatcggcggagacgggtcgctgaccggcctgaacctgctgcgc
aacgagtggtccggactggtggccgaacttgtggagcgcggcgacctggcacccgaggtc
gccgagcagcaccccagcctgatgatcgccggcctggtgggctccatcgacaacgacctg
gtgggctccgacatgacgatcggcgccgacaccgcgctgcaccgcatcgtcgacgccatc
gacgacctggcgtccaccgccgccagccaccagcgctccttcgtcgtggaggtgatggga
cgccactgcggctacctggctctgatgagcgccgtcgccggcggggcggactacgtcctg
gtccccgagcagcctccggcgccgggctgggaggacgagatgtgcgccgagctgcgcaag
ggccgcgagtcggggcgccgcgactccatcgtcatcatcgccgagggagcgaccgatcgc
gagggcaacccgatcagggccgagtacgtccgcaaggtgctggccgaaaggctcaacgag
gacgcccgggtcacgatcctggggcacgtccagcgcggcggaaagcccagcgcctacgac
cgctgggcctcgacctggctgggctactccgccgtccacgaggtgctcaccgccaccccc
gagtccgaggggatggtcgtcggcacccggtcgaaccgctccgagcgactctcactggtc
aaggcggtggccgacacccagcacgttcccgagctcatcgaggccggccagtaccacgag
gccatgcggatgcgcgggggctccttcctcgagatggacgccatcttctccgagctggca
gatccggcgcgcaccacgcccgaacccgactacaggaggatcgccgtgatgcacgccggg
gggccggcgccgggcatgaacacggccatgcgggccctcgtgcgactgggcatctcccgt
ggtcacaccatgatcggaatccacaacgggttcgtcggcctggccgccaacgacatggag
gagatcacctggagccaggtggaggggctcaccggcgagggcggcgcgatgctcggcaca
cgccgcgaggtaccccagacccaggacctgtacgcgatcagccgggccctggagaagaac
gacatcgacgcgctggtggtgatcggcggctattcggcctatgacggcgtccacaagatg
acgacggagcgggaccgctaccccgccttccggatccccaccgtctgcgtgcccgccagc
atcgacaacaaccttcccggctcggagctgtcgatcggcaccgacaccgctctgaacgtc
atcgtcgacgccatggacaagatcaaggagtccggtatcgcctccaagcggtgcttcgtg
gtggagacgatgggcaagaactgcggctacctcgcgatgatgagcggcatcgcggccggc
gccgagaggatctacctcaatgaggacggcatcagcctggacgatctggtcaccgacgtc
cactggctgagggagtccttcgcgaagggacgccggctcttcctggcggtgcgcaacgag
aacgcctcgaagaactacaccaccgagttcctcgcccagatgatggaggaggagtcccac
gggatgtacgacgtgcgcaccgccgtgctcggccacatgcagcagggagggtcgccctcc
cccttcgaccggctgctcgccacccggttcagctaccaggcgctcaacctggtggacgac
gagctcgcggtcggccaggtcggctcctggttcatggggatccgggagggcagcacccat
gccgggaagatggagaccatgtcctccctggtcgaccctcagcaccggcgaccgcgccac
cagtggtggctggacctgcgcacggtggcgcggaccctctctgatgagctcaggagctga

DBGET integrated database retrieval system