KEGG   Paludisphaera borealis: BSF38_03282Help
Entry
BSF38_03282       CDS       T04622                                 

Definition
(GenBank) hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pbor  Paludisphaera borealis
Brite
KEGG Orthology (KO) [BR:pbor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbor01002]
    BSF38_03282
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbor04147]
    BSF38_03282
   04090 CD Molecules [BR:pbor04090]
    BSF38_03282
Enzymes [BR:pbor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BSF38_03282
Peptidases [BR:pbor01002]
 Metallo Peptidases
  Family M2
   BSF38_03282
Exosome [BR:pbor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSF38_03282
CD molecules [BR:pbor04090]
 Proteins
  BSF38_03282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M3
Motif
Other DBs
NCBI-ProteinID: APW61754
UniProt: A0A1U7CS32
LinkDB All DBs
Position
4192889..4194781
Genome map
AA seq 630 aa AA seqDB search
MSRHEHEADAAAKDGGLDRRGFLRIAAGVAVGGAATASATAGQADPGLSQEVDAFLARYV
ERWLPLDTKASEAAWAAATDVTEAHTAAQVVANQAVNEVVGAPEVIADVTRFLAQKDKLG
ELQARQLEKIRLRAAEAPGTLPEVVKARTEAEARQSATQDGFVFTVKKADGKIENPSANK
IDQVLINSKDLDERKLYWTASKEIGGPLREGVLKLRDLRNQVARKLGFDDFFALQVADYG
MTVSQMVGLCDGIVADVKPLYLHLHTWAKHLLAKRYGADVPKGAIPAHWLPNRWGQNWPS
LVEGVDMDAPFKGRPREFITEQAERFYTSIGFPKLPPSFWSKSDLYPADPKTGRKKNSHA
SAWHIDLRDDVRSLMSIEPDNQWFGTAHHELGHIYYYMSYSTPKVPYLLRAGANRAFHEG
IGDLIGLASGQRPYLKQVGLLTPEAEKAPAVTFLLDTALDGASVVFLPWSAGVMTHFERD
FYAGTIADDALNAGWWRHVRGFQGIEPPAARPETLCDAATKTHINDDPAQYYDYAIGTVL
KFQLHDHIAREILKQDPRECNYFGNKKVGDFLRGILELGATRDWNAVLREATGEGLTARP
LVAYFEPLLKWLETENKGRALGWPEPTEKS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgacacgaacacgaagcagacgcggcggcgaaggacggcgggctggatcgtcgc
gggttcttgcgaatcgcggcgggcgtcgcggtcgggggggcggcgaccgcttcggccacg
gcggggcaggccgatccagggttgtcgcaggaggtcgacgcgttcctcgcgcggtacgtc
gagcgctggctgccgctggatacgaaggcgtcggaggcggcctgggcggcggcgacggac
gtgaccgaggcgcacacggcggctcaggtcgtggcgaaccaggcggtcaacgaggtcgtc
ggtgcgcccgaggtgatcgccgacgtcacccggttcctcgcccagaaggacaagctcggc
gagcttcaagcgcggcagcttgagaagatccggctccgcgcggccgaggcgcccgggacc
ttgcccgaggtcgtgaaggcgcggaccgaggccgaggccaggcagtcggcgacgcaggac
gggttcgtgttcacggtcaagaaggccgacgggaagatcgagaacccgtcggccaacaag
atcgaccaggtcctgatcaactcgaaggatctggacgagcggaagctctactggaccgcc
tcgaaggagatcggcgggccgctccgcgagggggtgctgaagctccgcgacctccgcaac
caggtcgcccgcaagctcggcttcgacgacttcttcgcgctccaggtcgccgactacggg
atgaccgtctcccagatggtcggcctctgcgacggcatcgtcgccgacgtcaagccttta
tatctccacctgcacacgtgggccaagcacctgctggcgaagcggtacggcgccgacgtc
cccaagggggcgatccccgcgcactggctgcccaaccgctgggggcagaactggccgagc
ctggtcgaaggggtcgacatggacgccccgttcaagggccgcccgcgcgagttcatcacc
gagcaggccgagcggttctacacgtcgatcggcttccccaagctgccgccgagcttttgg
tccaagtcggacctctacccggccgaccccaaaaccggccgcaagaagaacagccacgcg
agcgcctggcacatcgacctccgcgacgacgtccgcagcctgatgtcgatcgagcccgac
aaccagtggttcggcacggcccaccacgagcttgggcatatttattactacatgagctat
tcgacccccaaggtgccgtatctgctccgcgccggggccaaccgggcgttccacgagggg
atcggcgacctcatcggcctggcgtccggccagcgtccgtatctgaagcaggtcggcctc
ctgacccccgaggccgagaaggcgccggcggtcacgttcctgctcgacaccgcgctcgac
ggcgcttcggtcgtgttcctgccgtggtcggccggcgtgatgacccacttcgagcgcgac
ttctacgccgggacgatcgccgacgacgcgctcaacgccggctggtggcggcacgtccgg
gggttccaggggatcgagcctcccgccgcccgccccgaaaccctctgcgacgccgccacg
aagacgcatatcaacgacgaccccgcgcaatattatgattacgcgatcggcaccgtcctc
aagttccagctccacgaccacatcgcccgggagatcctcaagcaagacccgcgcgagtgc
aattacttcggcaacaagaaggtcggcgacttcctccggggcatcctcgaactcggcgcg
acccgcgactggaacgccgtgctccgcgaggccacgggcgaaggtttgacggctcgaccc
ctcgtcgcgtactttgaacctttgctcaagtggctcgaaaccgagaacaaggggcgggcg
ctgggctggcccgaacccactgagaaatcatga

DBGET integrated database retrieval system