KEGG   Paludisphaera borealis: BSF38_04405Help
Entry
BSF38_04405       CDS       T04622                                 

Gene name
mro
Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pbor  Paludisphaera borealis
Pathway
pbor00010  Glycolysis / Gluconeogenesis
pbor00052  Galactose metabolism
pbor01100  Metabolic pathways
pbor01110  Biosynthesis of secondary metabolites
pbor01120  Microbial metabolism in diverse environments
pbor01130  Biosynthesis of antibiotics
Module
pbor_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pbor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSF38_04405 (mro)
   00052 Galactose metabolism
    BSF38_04405 (mro)
Enzymes [BR:pbor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BSF38_04405 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim HCV_core
Motif
Other DBs
NCBI-ProteinID: APW62850
UniProt: A0A1U7CV78
LinkDB All DBs
Position
complement(5695032..5696072)
Genome map
AA seq 346 aa AA seqDB search
MSKVAFGKTPDGKTVDLYVLQNGRITVKISTYGAIITSIEVPDRDGKLDDVVLGFDDLTG
YLGKHPYFGATVGRVANRVAKGKFTLNGHEYTLATNNGPNTLHGGLKGFDKVVWKAEELE
SGDGPSVRLSYTSPDGEEGYPGNLSVSILFTVTADDKLKIEYTAETDKATPVNLSNHSYF
NLGGKNSDTIRDHEITLNADRYTPVDDTLIPTGEIAPVADTPYDLRKPTVIGARIDRLQN
EPRGFDHNFVLNNPDGKLTLAAHVYDPKSGRVLEVSTTEPGVQFYTGNFLDGTDKGKGGV
AYKQHQAICLETQHFPDSINHPSFPNTVLEPGKKYSQTTVYTFSTR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaaggtggcattcggcaagacgccggacggcaagacagtcgacctctacgtgctc
cagaacggccggatcaccgtcaagatttcgacctacggggcgatcatcacctcgatcgag
gttcccgaccgcgacggcaagctcgacgacgtcgtgctcggcttcgacgatctgaccggc
tacctgggcaagcatccgtacttcggcgccacggtcggccgcgtcgccaaccgcgtcgcc
aaggggaagttcacgctcaacgggcacgagtacacgctggcgaccaacaacggccccaac
acgctgcacggcggcctcaagggcttcgacaaggtcgtctggaaggccgaggagctggag
agcggcgacgggccgtcggtccggctgtcgtacacgagccccgacggcgaggaaggctat
ccgggcaacctgtcggtcagtatcctgttcaccgtgaccgccgacgacaagctgaagatc
gaatacacggccgagaccgacaaggccacgccggtgaatctctcgaaccacagttacttc
aacctcggcggcaagaacagcgacacgatccgcgaccacgagatcacgctgaacgccgac
cgctacacgcccgtcgacgacacgctgatccccaccggcgagatcgcccccgtcgccgac
acgccgtacgacctccgcaagccgaccgtgatcggcgcccggatcgatcgccttcagaac
gagcctcgcggcttcgatcacaacttcgtgctcaacaacccggacgggaagctgaccctc
gccgcgcacgtctacgacccgaagtcgggccgcgtgctggaggtgtcgacgaccgagccc
ggcgtccagttctacaccggcaacttcctcgacggcaccgacaagggcaaggggggcgtc
gcctacaagcagcatcaagccatctgcctggaaacccagcacttcccggactcgatcaac
cacccgtcgttccccaacacggtcctcgaacccggtaaaaagtactcccagacgacggtt
tacacgttctcgacgaggtga

DBGET integrated database retrieval system