KEGG   Paludisphaera borealis: BSF38_05581Help
Entry
BSF38_05581       CDS       T04622                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pbor  Paludisphaera borealis
Pathway
pbor00500  Starch and sucrose metabolism
pbor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSF38_05581
Enzymes [BR:pbor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BSF38_05581
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BSF38_05581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: APW63993
UniProt: A0A1U7CYM8
LinkDB All DBs
Position
7200284..7203655
Genome map
AA seq 1123 aa AA seqDB search
MRDDDGLWYKDAIIYEAHVRAFFDSNDDGVGDFRGLTLKLDYLRDLGVTAIWLLPFYPSP
LRDDGYDIADYTKVNKQYGRLSDFREFLETAHRLGMRVITELVLNHTSDQHEWFQRARTA
PAGSPERDFYVWSDTPDLYPEARIIFKDFEVSNWTWDPVANAYFWHRFYSHQPDLNYDNP
AVWEAVFPLVDFWFGMGVDGLRLDAVPYLYERPGTNCENLPETHEFLKALRKHVDEKFPT
PPRMFLAEANQWPEDAVAYFGDDDECHMAFHFPVMPRLFMALHQEDRFPILDILAQTPAI
PENSQWCMFLRNHDELTLEMVTDEERDSMYRAYAQDPEARINLGIRHRLAPLLYNDRRRI
ELMTALLFSLPGTPVLYYGDEIGMGDNIYLGDRNGVRTPMQWSPDRNAGFSNCNPQKLYF
PVITDSEYHYEAVNVESQQQNTSSLLWWTKRMIALRKQHRAFGRGTLDFLRPENAKILVF
VRSYEDERILVVANLSRFMQYVELDLREFQGCVPEELSGRSLLPPIDERPYRLTLSPYAF
YWFLLKPADAAKPALDGEPLRVGDLPALTVADDWRTELCGKDHARLGVILPSFLERRRPP
GVPRIVAAHITRSFADPMGSGDIQWLVVRVELDTGDTESSILPLTVIGEDDSSRLLESAS
TAVLARLTGNRTGLLCDAVAAPACGQELVQAIQAGMTAPLADGELAAVALKGLAEAVGDA
HTLVPSHLIRGERFNATLVFDERLTLKTFRSVETEINPDFEIRTFLSARQEAPIVAPVLG
YIEYRRVHGPPVTVAVLNQYIPNHGTAWHLTINQLSQFYERVAAHSHRRISETPSDPNPA
VPDPGAEASLEEIIGGFESIARKIGVQTALLHRTLASDSRAADFRPEPFGRLYQRSLYQA
MRNLTHQVFTRLTFELPRLTEPVKADAARLLSLREPLLERFREVADTPLGGSRIRIHGDY
ELDQLVYTGTDFVVIDFEADLEDSTGERRVKRSPLRDVAAMIRSFDYAAHSVLFDLEHKE
GRPPGLVRHEDRSALEPWARRWQSRISRQFVDAYFESLDRPGLLPATRSQCEFLLDVMLL
ERALDEVGRDMARRPDWMVVPLRALLRMLEPEAPPPSNEVLGV
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagacgacgacggtctttggtacaaggatgcgatcatctatgaggcccacgtgcgg
gccttcttcgacagcaacgacgacggcgtcggcgattttcgcgggctgacgttgaagctc
gactatctgcgcgacctgggggtcacggcgatctggctcttgccgttctatccgtcgccg
ttgcgcgacgacgggtacgacatcgccgactacacgaaggtcaacaagcagtacgggcgg
ctgtcggacttccgcgagtttctggagaccgctcatcgtctcgggatgagggtcatcacc
gagctggtgctcaaccacacgtcggaccagcacgagtggttccagcgcgcgcggacggcg
ccggcggggagccccgagcgcgacttctacgtctggagcgacacgccggacctctatccc
gaggcccggatcatcttcaaggacttcgaggtctcgaactggacgtgggacccggtggcg
aacgcctacttctggcaccggttctattcccatcagcccgatctcaactacgacaacccc
gccgtctgggaagcggtgttcccgctcgtcgatttctggttcggcatgggggtcgacggt
ctccggctcgacgccgttccgtacctctacgaacgccccgggaccaactgcgagaacctc
cccgagacgcacgagttcttgaaagccttgcgcaagcacgtcgacgagaagtttccgacg
cccccgcggatgttcctcgccgaggccaaccagtggcccgaggacgccgtggcgtatttc
ggcgacgacgacgaatgccacatggcgttccacttcccggtcatgcctcggctgttcatg
gcgctgcatcaggaagaccggtttccgatcctcgacatccttgcccagacgccggccatt
cccgaaaacagccagtggtgcatgttcctccgcaaccacgacgagctgacgcttgaaatg
gtgacggacgaggaacgcgattcgatgtatcgggcctacgcccaggaccccgaggcgcgg
atcaacctgggcatccgccatcgcctcgcgccgctgttgtacaacgaccggaggcggatc
gagctgatgaccgcgctgttgttctcgctgcccggcacgccggtgctttattacggcgac
gagatcggcatgggcgacaacatctacctcggcgatcgcaacggcgtgcggacgccgatg
cagtggtcgcccgaccgcaacgcggggttctcgaactgcaacccgcagaagctctacttc
ccggtgatcaccgattcggagtaccactacgaggcggtcaacgtcgagagccagcagcag
aacaccagctcgctgctctggtggacgaagcggatgatcgcgctgcgcaaacagcatcgg
gcgttcggccgggggacgttggatttcctccgccccgagaacgccaagatcctcgtgttc
gtccggagctatgaggacgagcgcatcctggtcgtggccaacctttcgcgattcatgcaa
tacgtcgagctcgacctccgcgagttccagggatgcgtccccgaggagctttccgggcgc
agcctgctgccgccgatcgacgagcggccgtatcgattgacgctttcgccttacgccttc
tactggttcttgctgaagccggccgacgccgctaagccggccctggacggcgagccgctg
cgcgtgggcgatctgcccgcgctgacggtcgccgacgactggcggaccgaactgtgcggc
aaggatcacgcgcggttgggggtgatcttgccgagctttctggagcgtcggcggccgccg
ggcgtgccccggatcgtcgccgcccacatcacgcgatcgttcgccgaccccatgggatcg
ggcgacatccagtggctcgtcgtccgcgtcgagctcgacacgggcgataccgaatcaagc
atcctgccgctgacggtgatcggcgaggacgactcgtcgcggcttctcgaatcggcgtcg
accgccgtgctggcgcggttgacggggaatcgaacgggcttgctctgcgacgcggtcgcc
gcccccgcctgcggccaggaactcgtgcaggcgatccaggccggcatgaccgcgcccctg
gccgacggcgagctggcggccgtggctttgaaggggttggccgaggccgtgggcgacgcc
cacacgctggttccctcccacctcatccgcggcgaacgcttcaacgccacgctcgtcttc
gacgagcggctgaccctcaagacgttccggagcgtcgagaccgaaatcaatcccgacttc
gagatccgcaccttcctctcggcccggcaggaggccccgatcgttgcgccggtgcttggt
tatatcgagtatcgccgggtccacggcccgccggtgacggtcgccgtgctgaaccagtac
atccccaatcatgggacggcctggcatctgacgatcaaccagctcagccagttctacgaa
cgggtcgcggcgcattcgcaccggcggatctccgagacgccgagcgaccccaaccccgcg
gttcccgaccctggcgccgaggcgtcgcttgaggagatcatcggcggcttcgagagcatc
gcgcggaagatcggggttcagacggccctgctccaccgcacgctcgcgtcggattcgcgg
gccgccgatttccgccccgagccgttcggtcggctctatcagcggtcgctctaccaggcg
atgcggaacctgactcatcaggttttcacccggctgacgttcgaacttcccagactgacg
gaaccggtcaaggccgacgccgcgcgcttgctcagccttcgcgagccgctgctcgaacgc
tttcgagaggtcgctgacacgccgctgggcgggtcgcgaatccggattcacggcgactat
gaactcgaccagctcgtttataccgggaccgacttcgtcgtgatcgacttcgaggccgat
ctcgaagactcgacgggcgagcgccgggtcaaacggtcgccgctccgcgacgtggccgcg
atgatccggtcgttcgattacgcggcccacagcgtgcttttcgacctcgaacacaaggaa
ggccggccccccggcctggtccggcatgaggaccgctcggccctggagccgtgggcccgg
cgctggcagtcgcggatctcccgccagttcgtcgacgcctacttcgaatcgctcgaccgc
cccggcctcctccccgcgacccggagccagtgcgagtttttgctcgacgtcatgctgctc
gaacgggcgctcgacgaggtcggccgcgacatggcccgccgccccgactggatggtcgtc
ccgctccgcgctctgctgcggatgctcgaacccgaagcgccgccgccgtcgaatgaagtg
ctcggggtttga

DBGET integrated database retrieval system