KEGG   Phycisphaerae bacterium ST-PulAB-D4: STSP1_01817Help
Entry
STSP1_01817       CDS       T05439                                 

Gene name
mro_2
Definition
(GenBank) Aldose 1-epimerase precursor
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pbp  Phycisphaerae bacterium ST-PulAB-D4
Pathway
pbp01100  Metabolic pathways
pbp01110  Biosynthesis of secondary metabolites
pbp01120  Microbial metabolism in diverse environments
pbp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STSP1_01817 (mro_2)
   00052 Galactose metabolism
    STSP1_01817 (mro_2)
Enzymes [BR:pbp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     STSP1_01817 (mro_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ARN57410
UniProt: A0A1W6LNM9
LinkDB All DBs
Position
2419523..2420692
Genome map
AA seq 389 aa AA seqDB search
MLLRKLSILSLALCVLVLSSCTETQKNDSPKKCPKQSLKPSVEKSFFGTTKDGQKVYEYV
LDNGKGMDAGIITYGGVMTYLNVPDKNGKSGDILLGFDNLKDFEEKSDYFNALIGRYGNR
IAKGKFELNGKTYTLATNNGENHLHGGDRGFDKRVWSATHSVTEDAANLTLTYLSKDGEE
GYPGNLRCVVTYSITTGNELVIDYKAETDKATPVNLTQHNYYNLDGQGSGKILDHKLMIN
ASQMTPVDEGLIPTGEIVDVYGPFDFTEPKKIGKHINSADIQMKYGKGYDHNFVLDKGKG
MGLAAKVYEPDSGRIMEVWTEEPGLQFYSGNFLDGTIVGKEGKRYVQRCAFCLETQHFPD
SPNKPQFPSTILKPGEVYNTKTIYKFKTK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgcgtaaactttcaatcttatcattagcgctttgcgttttagtgctttcatca
tgcactgaaacccagaagaacgactcacccaagaaatgccccaaacagagtcttaagcct
tctgttgagaagagcttcttcggcaccaccaaagacgggcagaaggtgtacgaatacgtg
ctcgataacggcaaaggtatggatgccggaattattacctacggcggggtaatgacgtat
ctcaacgtgccggataagaacggcaaaagcggtgatatcctcttgggcttcgataatctc
aaggatttcgaggagaagagcgattacttcaacgcccttatcggaagatacggcaaccgt
attgccaagggcaagtttgagctgaacggcaaaacatacaccctcgccacaaacaacggc
gaaaaccacctccacggcggggacaggggcttcgataagcgtgtgtggtctgctacgcat
tcagtaactgaagatgctgcaaacctcactctcacctacctcagcaaagacggagaggaa
ggatacccgggcaacctccgctgcgttgtaacttattctatcactaccggcaatgagctg
gtaatagattacaaggccgaaacggacaaggctacgcctgtgaacctcacccagcataac
tactacaaccttgatggacagggcagcgggaaaatcctcgaccataaacttatgataaat
gcttcacaaatgacgcctgtggatgaagggcttatccccaccggcgagatcgtggatgtt
tatgggcctttcgattttacagagccgaagaaaatcggcaaacacataaactctgctgat
atacagatgaaatacggcaaaggctacgaccacaactttgtgctcgataaaggcaagggt
atgggtcttgcggccaaggtttacgagcctgacagcggcagaattatggaagtttggaca
gaagagccaggccttcagttctacagcggcaatttccttgatggaacaatcgtgggcaag
gaaggcaaaagatacgttcagagatgcgctttctgtcttgaaacgcagcacttcccagac
tcaccaaacaaacctcagttcccctcaactatcctgaagcctggagaggtttacaacaca
aaaactatttacaaattcaaaactaaataa

DBGET integrated database retrieval system